Property Summary

NCBI Gene PubMed Count 32
Grant Count 6
R01 Count 3
Funding $384,949.43
PubMed Score 69.05
PubTator Score 46.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis -1.400 0.015
breast carcinoma -2.500 0.003
fibroadenoma -3.400 0.020
psoriasis -1.500 0.000
ductal carcinoma in situ -4.100 0.000
invasive ductal carcinoma -4.400 0.000

Gene RIF (20)

PMID Text
26367078 data suggested that Cidec could interact with and down-regulate AMPKalpha through an ubiquitin-proteasome degradation pathway, which provided a possible mechanism of Cidec in promoting human adipocytes differentiation
26099526 Hepatic expression of FSP27/CIDEC is highly up-regulated in in patients with alcoholic steatohepatitis and this up-regulation contributes to alcohol-induced liver damage.
25210844 It is insinuated that VAT is associated with late phase obesity CIDEC decrease and insulin resistance, while pioglitazone enhances CIDEC through activation of PPAR-gamma, increases its expression, and decreases lipolysis.
24742676 Data indicate that fat-specific protein 27 (FSP27) increases the inhibitory effect of transcription factor Egr1 on the adipose triglyceride lipase (ATGL) promoter.
24627478 results demonstrate a crucial role for FSP27-ATGL interactions in regulating lipolysis, triglyceride accumulation, and insulin signaling in human adipocytes
24126816 After bariatric surgery-induced weight loss, CIDEC/FSP27 gene/protein expression in SAT increased significantly. Findings suggest a positive functional interaction between CIDEC/FSP27 & mitochondrial biogenesis-related genes in human adipose tissue
24025675 homo-dimeric structure of the CIDE-N domain of FSP27 will provide important information that will enable better understanding of the function of FSP27.
23475172 CIDE proteins expression correlate with tumor and survival characteristics in patients with renal cell carcinoma.
23233732 The results suggest that FSP27 not only modulates LD homeostasis but also modulates the response to osmotic stress via a physical interaction with NFAT5 at the LD surface.
23220584 Fsp27/CIDEC is a CREB target gene induced during early fasting in liver and regulated by FA oxidation rate.
More...

AA Sequence

MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKV      1 - 70
RDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDV     71 - 140
ARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQ    141 - 210
QLLDATEEGQPPKGKASSLIPTCLKILQ                                              211 - 238
//

Text Mined References (34)

PMID Year Title
26367078 2015 Cidec promotes the differentiation of human adipocytes by degradation of AMPK? through ubiquitin-proteasome pathway.
26099526 2015 Fat-Specific Protein 27/CIDEC Promotes Development of Alcoholic Steatohepatitis in Mice and Humans.
25210844 2014 Effects of pioglitazone mediated activation of PPAR-? on CIDEC and obesity related changes in mice.
24742676 2014 Fat-specific protein 27 inhibits lipolysis by facilitating the inhibitory effect of transcription factor Egr1 on transcription of adipose triglyceride lipase.
24627478 2014 Fat-specific protein 27 (FSP27) interacts with adipose triglyceride lipase (ATGL) to regulate lipolysis and insulin sensitivity in human adipocytes.
24126816 2014 CIDEC/FSP27 and PLIN1 gene expression run in parallel to mitochondrial genes in human adipose tissue, both increasing after weight loss.
24025675 2013 Molecular basis for homo-dimerization of the CIDE domain revealed by the crystal structure of the CIDE-N domain of FSP27.
23475172 2013 Expression of CIDE proteins in clear cell renal cell carcinoma and their prognostic significance.
23399566 2013 FSP27 and PLIN1 interaction promotes the formation of large lipid droplets in human adipocytes.
23233732 2013 Fat-specific protein 27 modulates nuclear factor of activated T cells 5 and the cellular response to stress.
More...