Property Summary

NCBI Gene PubMed Count 33
PubMed Score 78.51
PubTator Score 46.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis -1.400 1.5e-02
breast carcinoma -2.500 3.1e-03
ductal carcinoma in situ -4.100 1.1e-04
fibroadenoma -3.400 2.0e-02
invasive ductal carcinoma -4.400 2.7e-04
psoriasis -1.300 5.0e-04

Protein-protein Interaction (3)

Gene RIF (21)

AA Sequence

MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKV      1 - 70
RDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDV     71 - 140
ARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQ    141 - 210
QLLDATEEGQPPKGKASSLIPTCLKILQ                                              211 - 238
//

Text Mined References (35)

PMID Year Title