Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.51
PubTator Score 25.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma 1.200 0.000
psoriasis -1.700 0.000
osteosarcoma -1.647 0.001
group 4 medulloblastoma -2.100 0.000
astrocytoma 2.300 0.006
medulloblastoma, large-cell -2.200 0.000
lung cancer -1.200 0.006
Down syndrome 1.100 0.002
dermatomyositis -1.100 0.002

Synonym

Accession Q96AQ6 Q5T174 Q5T176 Q9H8X6 Q9HA02 Q9HD85
Symbols HPIP

Gene

Gene RIF (5)

PMID Text
26497366 Copy number variations in PBXIP1 gene is associated with lung adenocarcinoma.
25060351 HPIP may play critical role in oral carcinogenesis and is potential target for anticancer therapy, with particular emphasis on its involvement in differentiation and migration/metastasis.
24470547 PBXIP1 is a novel protein overexpressed in astrocytoma and ependymoma, involved in tumor cell proliferation and migration
24038948 These data highlight the important role of HPIP in liver cancer cell growth and suggest that HPIP may be a good target for liver cancer therapy.
22187427 HPIP is a target of GATA1 and CTCF in erythroid cells and plays an important role in erythroid differentiation by modulating the PI3K/AKT pathway

AA Sequence

MASCPDSDNSWVLAGSESLPVETLGPASRMDPESERALQAPHSPSKTDGKELAGTMDGEGTLFQTESPQS      1 - 70
GSILTEETEVKGTLEGDVCGVEPPGPGDTVVQGDLQETTVVTGLGPDTQDLEGQSPPQSLPSTPKAAWIR     71 - 140
EEGRCSSSDDDTDVDMEGLRRRRGREAGPPQPMVPLAVENQAGGEGAGGELGISLNMCLLGALVLLGLGV    141 - 210
LLFSGGLSESETGPMEEVERQVLPDPEVLEAVGDRQDGLREQLQAPVPPDSVPSLQNMGLLLDKLAKENQ    211 - 280
DIRLLQAQLQAQKEELQSLMHQPKGLEEENAQLRGALQQGEAFQRALESELQQLRARLQGLEADCVRGPD    281 - 350
GVCLSGGRGPQGDKAIREQGPREQEPELSFLKQKEQLEAEAQALRQELERQRRLLGSVQQDLERSLQDAS    351 - 420
RGDPAHAGLAELGHRLAQKLQGLENWGQDPGVSANASKAWHQKSHFQNSREWSGKEKWWDGQRDRKAEHW    421 - 490
KHKKEESGRERKKNWGGQEDREPAGRWKEGRPRVEESGSKKEGKRQGPKEPPRKSGSFHSSGEKQKQPRW    491 - 560
REGTKDSHDPLPSWAELLRPKYRAPQGCSGVDECARQEGLTFFGTELAPVRQQELASLLRTYLARLPWAG    561 - 630
QLTKELPLSPAFFGEDGIFRHDRLRFRDFVDALEDSLEEVAVQQTGDDDEVDDFEDFIFSHFFGDKALKK    631 - 700
RSGKKDKHSQSPRAAGPREGHSHSHHHHHRG                                           701 - 731
//

Text Mined References (31)

PMID Year Title
26497366 2015 Identification of hallmarks of lung adenocarcinoma prognosis using whole genome sequencing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25486428 2015 Hematopoietic PBX-interacting protein (HPIP) is over expressed in breast infiltrative ductal carcinoma and regulates cell adhesion and migration through modulation of focal adhesion dynamics.
25416956 2014 A proteome-scale map of the human interactome network.
25060351 2015 Potential role of hematopoietic pre-B-cell leukemia transcription factor-interacting protein in oral carcinogenesis.
24470547 2014 Pre-B-cell leukemia homeobox interacting protein 1 is overexpressed in astrocytoma and promotes tumor cell growth and migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24038948 2013 HPIP is upregulated in liver cancer and promotes hepatoma cell proliferation via activation of G2/M transition.
23825676 2013 Genomic signatures predict poor outcome in undifferentiated pleomorphic sarcomas and leiomyosarcomas.
23593351 2013 Expression of regulatory platelet microRNAs in patients with sickle cell disease.
More...