Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -2.200 0.040
ependymoma -2.700 0.034
glioblastoma multiforme -1.100 0.000
oligodendroglioma -1.200 0.000
group 3 medulloblastoma -2.200 0.002
primitive neuroectodermal tumor -1.400 0.002
non-small cell lung cancer -2.689 0.000
fibroadenoma 2.200 0.033
pediatric high grade glioma -1.400 0.000
atypical teratoid/rhabdoid tumor -1.500 0.000
pilocytic astrocytoma -1.200 0.001
subependymal giant cell astrocytoma -2.698 0.006
lung adenocarcinoma -1.100 0.013
nasopharyngeal carcinoma -1.100 0.000
lung carcinoma -1.100 0.000
spina bifida -1.304 0.040
Pick disease -1.300 0.005
progressive supranuclear palsy -1.300 0.038
invasive ductal carcinoma 1.300 0.004
ovarian cancer 1.200 0.000
pituitary cancer -1.400 0.000

AA Sequence

MSEQEAQAPGGRGLPPDMLAEQVELWWSQQPRRSALCFVVAVGLVAGCGAGGVALLSTTSSRSGEWRLAT      1 - 70
GTVLCLLALLVLVKQLMSSAVQDMNCIRQAHHVALLRSGGGADALVVLLSGLVLLVTGLTLAGLAAAPAP     71 - 140
ARPLAAMLSVGIALAALGSLLLLGLLLYQVGVSGHCPSICMATPSTHSGHGGHGSIFSISGQLSAGRRHE    141 - 210
TTSSIASLI                                                                 211 - 219
//

Text Mined References (4)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.