Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -2.200 4.0e-02
Astrocytoma, Pilocytic -1.300 8.6e-04
atypical teratoid/rhabdoid tumor -1.500 8.8e-06
ependymoma -2.700 3.4e-02
fibroadenoma 2.200 3.3e-02
glioblastoma multiforme -1.100 2.7e-08
group 3 medulloblastoma -2.200 1.5e-03
invasive ductal carcinoma 1.300 4.0e-03
lung adenocarcinoma -1.100 1.3e-02
lung carcinoma -1.100 8.6e-18
nasopharyngeal carcinoma -1.100 1.3e-07
non-small cell lung cancer -2.689 2.1e-15
oligodendroglioma -1.200 1.7e-08
ovarian cancer 1.200 5.0e-05
pediatric high grade glioma -1.400 1.4e-04
Pick disease -1.300 5.2e-03
pituitary cancer -1.400 2.8e-05
primitive neuroectodermal tumor -1.400 2.4e-03
progressive supranuclear palsy -1.300 3.8e-02
spina bifida -1.304 4.0e-02
subependymal giant cell astrocytoma -2.698 5.5e-03

AA Sequence

MSEQEAQAPGGRGLPPDMLAEQVELWWSQQPRRSALCFVVAVGLVAGCGAGGVALLSTTSSRSGEWRLAT      1 - 70
GTVLCLLALLVLVKQLMSSAVQDMNCIRQAHHVALLRSGGGADALVVLLSGLVLLVTGLTLAGLAAAPAP     71 - 140
ARPLAAMLSVGIALAALGSLLLLGLLLYQVGVSGHCPSICMATPSTHSGHGGHGSIFSISGQLSAGRRHE    141 - 210
TTSSIASLI                                                                 211 - 219
//

Text Mined References (4)

PMID Year Title