Property Summary

NCBI Gene PubMed Count 20
Grant Count 141
R01 Count 84
Funding $14,950,027.08
PubMed Score 357.64
PubTator Score 29.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.933 0.004
glioblastoma 1.200 0.000
non-small cell lung cancer -2.253 0.000
interstitial cystitis 1.200 0.001
lung adenocarcinoma -1.700 0.000
lung carcinoma -1.300 0.000
spina bifida -1.111 0.041
invasive ductal carcinoma -1.200 0.005

Synonym

Accession Q96AP7 B4DVN8 Q96T50
Symbols W117m

Gene

PANTHER Protein Class (1)

Gene RIF (7)

PMID Text
26774386 ESAM is a novel human hematopoietic stem cell marker associated with a subset of human leukemias
26523992 sESAM levels associate with myocardial infarction, heart failure, and death after adjustment for demographic and clinical risk factors, but not after adjustment for kidney function.
24456423 Serum ESAM is higher in type 2 diabetes mellitus than in controls and parallels oxidative stress.
24177327 sESAM is associated with albuminuria and reduced kidney function in patients with coronary artery disease in both cross-sectional and longitudinal analyses.
20153339 ESAM regulates tumor metastasis through endothelial cell migration and tube formation in metastatic nodules.
19759376 sESAM is a predictive biomarker and potential mediator of atherosclerosis.
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPF      1 - 70
VMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGH     71 - 140
SIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLS    141 - 210
LTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEE    211 - 280
PANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTT    281 - 350
DGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV                                  351 - 390
//

Text Mined References (22)

PMID Year Title
26774386 2016 ESAM is a novel human hematopoietic stem cell marker associated with a subset of human leukemias.
26523992 2015 Soluble endothelial cell selective adhesion molecule and cardiovascular outcomes in patients with stable coronary disease: A report from the Heart and Soul Study.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24456423 2014 Relationship of endothelial cell selective adhesion molecule to markers of oxidative stress in type 2 diabetes.
24177327 2014 Role of soluble endothelial cell-selective adhesion molecule biomarker in albuminuria and kidney function changes in patients with coronary artery disease: the Heart and Soul Study.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
20153339 2010 Role of endothelial cell-selective adhesion molecule in hematogeneous metastasis.
19759376 2009 Differential associations between soluble cellular adhesion molecules and atherosclerosis in the Dallas Heart Study: a distinct role for soluble endothelial cell-selective adhesion molecule.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
More...