Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.2e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.467 1.2e-06

Gene RIF (3)

AA Sequence

MTVELWLRLRGKGLAMLHVTRGVWGSRVRVWPLLPALLGPPRALSSLAAKMGEYRKMWNPREPRDWAQQY      1 - 70
RERFIPFSKEQLLRLLIQEFHSSPAEKAALEAFSAHVDFCTLFHYHQILARLQALYDPINPDRETLDQPS     71 - 140
LTDPQRLSNEQEVLRALEPLLAQANFSPLSEDTLAYALVVHHPQDEVQVTVNLDQYVYIHFWALGQRVGQ    141 - 210
MPLKSSVGSRRGFFTKLPPAERRYFKRVVLAARTKRGHLVLKSFKDTPLEGLEQLLPELKVRTPTLQRAL    211 - 280
LNLMLVVSGVAIFVNVGMVVLTDLKVATSLLLLLFAIFMGLRASKMFGQRRSAQALELAHMLYYRSTSNN    281 - 350
SELLSALALRAQDEHTKEALLAHSFLARRPGGTQGSPEETSRWLRSEVENWLLAKSGCEVTFNGTRALAH    351 - 420
LQALTPSMGLYPPPGFPKLDPVAPITSEPPQATPSSNIS                                   421 - 459
//

Text Mined References (8)

PMID Year Title