Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.28
PubTator Score 275.07

Knowledge Summary

Patent (4,251)

Expression

  Differential Expression (11)

AA Sequence

MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFG      1 - 70
FSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAE     71 - 140
RCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCC    141 - 210
PLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCI    211 - 280
CINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS           281 - 343
//

Text Mined References (10)

PMID Year Title