Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.28
PubTator Score 275.07

Knowledge Summary

Patent (4,251)

Expression

Synonym

Accession Q96AM1 B3KV43 Q8NBK8 Mas-related gene F protein
Symbols RTA
MRGF
GPR140
GPR168

Gene

PANTHER Protein Class (2)

  TechDev Info (2)

Bryan Roth functional assay
Steve Finkbeiner Neuron specific phenotypes being screened

AA Sequence

MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFG      1 - 70
FSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAE     71 - 140
RCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCC    141 - 210
PLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCI    211 - 280
CINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS           281 - 343
//

Text Mined References (10)

PMID Year Title
24583173 2014 Comparative genomic analysis of eutherian Mas-related G protein-coupled receptor genes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11551509 2001 A diverse family of GPCRs expressed in specific subsets of nociceptive sensory neurons.
11181995 2001 The sequence of the human genome.
2109324 1990 RTA, a candidate G protein-coupled receptor: cloning, sequencing, and tissue distribution.