Property Summary

NCBI Gene PubMed Count 22
PubMed Score 26.39
PubTator Score 70.88

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96AK3 Q5JZ91 Q7Z2N2 Q7Z2N5 Q7Z2N6 A3D
Symbols A3D
ARP6
APOBEC3E
APOBEC3DE

Gene

PANTHER Protein Class (2)

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Horse OMA EggNOG

Gene RIF (37)

PMID Text
25461536 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
25408426 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
25352838 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
25330146 APOBEC3D/F and APOBEC3G fundamentally work as restriction factors against HIV-1 in vivo
25330146 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
25206352 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
24657093 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
24227842 APOBEC3 deaminases upregulated by IFN-beta induce E2 hypermutation of HPV16 in cervical keratinocytes.
24189052 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
23755966 We found that two common novel polymorphisms in APOBEC3D decrease antiviral activity against HIV-1, and one polymorphism decreases activity against Alu retrotransposons in the human population.
More...

AA Sequence

MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQE      1 - 70
VYFRFENHAEMCFLSWFCGNRLPANRRFQITWFVSWNPCLPCVVKVTKFLAEHPNVTLTISAARLYYYRD     71 - 140
RDWRWVLLRLHKAGARVKIMDYEDFAYCWENFVCNEGQPFMPWYKFDDNYASLHRTLKEILRNPMEAMYP    141 - 210
HIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNT    211 - 280
NYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFV    281 - 350
SCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ                                      351 - 386
//

Text Mined References (27)

PMID Year Title
25330146 2014 APOBEC3D and APOBEC3F potently promote HIV-1 diversification and evolution in humanized mouse model.
24227842 2014 APOBEC3 deaminases induce hypermutation in human papillomavirus 16 DNA upon beta interferon stimulation.
23755966 2013 Identification and antiviral activity of common polymorphisms in the APOBEC3 locus in human populations.
23152537 2013 Suppression of HIV-1 infection by APOBEC3 proteins in primary human CD4(+) T cells is associated with inhibition of processive reverse transcription as well as excessive cytidine deamination.
23097438 2013 APOBEC3G restricts HIV-1 to a greater extent than APOBEC3F and APOBEC3DE in human primary CD4+ T cells and macrophages.
22915799 2012 HIV-1 replication and APOBEC3 antiviral activity are not regulated by P bodies.
22912627 2012 Retroelements versus APOBEC3 family members: No great escape from the magnificent seven.
22807680 2012 Endogenous origins of HIV-1 G-to-A hypermutation and restriction in the nonpermissive T cell line CEM2n.
22001110 2012 Functions and regulation of the APOBEC family of proteins.
21835787 2011 Human and rhesus APOBEC3D, APOBEC3F, APOBEC3G, and APOBEC3H demonstrate a conserved capacity to restrict Vif-deficient HIV-1.
More...