Property Summary

NCBI Gene PubMed Count 39
Grant Count 11
R01 Count 7
Funding $504,380.15
PubMed Score 13.75
PubTator Score 10.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
25744365 The AA genotype of VTI1A (rs7086803) polymorphism had an increased risk of developing NSCLC compared with the GG genotype. Smoking lung cancer patients with the AA genotype of VTI1A gene (rs7086803) had a poor survival rate.
25105248 analysis of a new susceptibility locus for colorectal cancer in VTI1A [meta-analysis]
23677696 Data indicate that depletion of VAMP4, syntaxin 6, syntaxin 16, and Vti1a disrupted the Golgi ribbon structure.
22190034 HIV-1 gp41 is identified to have a physical interaction with vesicle transport through interaction with t-SNAREs homolog 1A (VTI1A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21892161 We found a colorectal carcinoma cell line harboring the fusion gene to be dependent on VTI1A-TCF7L2 for anchorage-independent growth using RNA interference-mediated knockdown.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19138172 The present results suggest that a SNARE complex containing VAMP7 and Vti1a defines a novel traffic pathway to the cell surface in both neuronal and non-neuronal cells.
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVREIPPQSRGMY      1 - 70
SNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDNTERLERSSRRLEAGYQIAV     71 - 140
ETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVILGIIVVITILMAI    141 - 210
TFSVRRH                                                                   211 - 217
//

Text Mined References (42)

PMID Year Title
26424050 2015 Genome-wide association study identifies multiple susceptibility loci for glioma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25771401 2015 A population study of binocular function.
25744365 2015 Single nucleotide polymorphisms in VTI1A gene contribute to the susceptibility of Chinese population to non-small cell lung cancer.
25105248 2014 Trans-ethnic genome-wide association study of colorectal cancer identifies a new susceptibility locus in VTI1A.
25002402 2014 Endosomal sorting of VAMP3 is regulated by PI4K2A.
24943349 2014 Whole genome sequencing reveals potential targets for therapy in patients with refractory KRAS mutated metastatic colorectal cancer.
24692499 2014 Associations between 25 lung cancer risk-related SNPs and polycyclic aromatic hydrocarbon-induced genetic damage in coke oven workers.
24608966 2014 High frequency of fusion transcripts involving TCF7L2 in colorectal cancer: novel fusion partner and splice variants.
24095276 2013 Syntaxin 13, a genetic modifier of mutant CHMP2B in frontotemporal dementia, is required for autophagosome maturation.
More...