Property Summary

NCBI Gene PubMed Count 15
PubMed Score 19.57
PubTator Score 11.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 5.2e-04
adult high grade glioma 3801 9.1e-04
glioblastoma 5792 1.6e-03
osteosarcoma 7950 2.2e-03
medulloblastoma, large-cell 6241 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Premature ejaculation 16 3.642 1.8
Meckel syndrome 46 3.318 1.7
Varicocele 26 3.163 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.400 9.1e-04
glioblastoma -1.100 1.6e-03
medulloblastoma, large-cell -1.100 1.4e-02
osteosarcoma 1.172 2.2e-03
ovarian cancer 1.200 5.2e-04

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MSFRDLRNFTEMMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPPDVDTEQDRVFFIKAIA      1 - 70
QFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAA     71 - 140
RQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDE    141 - 210
ANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRME    211 - 280
QERFEEAKNTLCLIQNKLKEEEKRLLKSGSNDDSDIDIQEDDESDSELEERRLPKPQTAMEMLMQGRPGK    281 - 350
RIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRVRKSEPLDESDNDF           351 - 413
//

Text Mined References (18)

PMID Year Title