Property Summary

NCBI Gene PubMed Count 11
PubMed Score 17.37
PubTator Score 11.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -4.138 0.000
glioblastoma -1.100 0.002
medulloblastoma, large-cell -1.100 0.014
adult high grade glioma -1.400 0.001
ovarian cancer 1.200 0.001

Synonym

Accession Q96AJ1 O75138 Q65ZA3 Q9H8R4 Q9H8T1
Symbols FAP22
IFT38
CFAP22

Gene

 GO Process (1)

Gene RIF (2)

PMID Text
17203229 CLUAP1 (clusterin-associated protein 1) is highly expressed in osteosarcoma, ovarian, colon, and lung cancers
15480429 inactivation of CLUAP1 may conceivably serve in the future as a novel therapeutic intervention for treatment of colon cancer

AA Sequence

MSFRDLRNFTEMMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPPDVDTEQDRVFFIKAIA      1 - 70
QFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAA     71 - 140
RQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDE    141 - 210
ANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRME    211 - 280
QERFEEAKNTLCLIQNKLKEEEKRLLKSGSNDDSDIDIQEDDESDSELEERRLPKPQTAMEMLMQGRPGK    281 - 350
RIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRVRKSEPLDESDNDF           351 - 413
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19253336 2009 Characterization of mouse IFT complex B.
17203229 2007 Identification of CLUAP1 as a human osteosarcoma tumor-associated antigen recognized by the humoral immune system.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15530380 2004 Human cilia proteome contains homolog of zebrafish polycystic kidney disease gene qilin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15480429 2004 Isolation and characterization of a novel gene CLUAP1 whose expression is frequently upregulated in colon cancer.
More...