Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 4.92

Knowledge Summary

Patent

No data available

Gene RIF (10)

PMID Text
25996526 Authors determined the effects of T. suis soluble products (SPs) on Toll-like receptor-4 (TLR4)- In addition, T. suis SPs induce Rab7b, a negative regulator of TLR4 signalling
24173214 Inhibition of endocytosis by siRNA-mediated depletion of EPS15, STX7, RAB7, and VAMP7 restores Gag/p24 expression in the presence of APOL1
24173214 Inhibition of endocytosis by siRNA-mediated depletion of EPS15, STX7, RAB7, and VAMP7 restores Gag/p24 expression in the presence of APOL1
23345514 Rab9a and Rab7b are mediators of the transit of the L2 capsid protien and the pseudogenome of human papillomavirus 16 from the late endosome to the golgi complex.
22708738 Rab7b is required for sortilin transport from endosomes to the TGN.
20953574 Rab7b may play important roles in megakaryopoiesis by activating NF-kappaB and promoting IL-6 production.
20459747 Inhibition of endocytosis by siRNA-mediated depletion of EPS15, STX7, RAB7, and VAMP7 restores Gag/p24 expression in the presence of APOL1
20375062 Rab7b is required for normal lysosome function, and, in particular, it is an essential factor for retrograde transport from endosomes to the trans-Golgi network.
20012524 Inhibition of endocytosis by siRNA-mediated depletion of EPS15, STX7, RAB7, and VAMP7 restores Gag/p24 expression in the presence of APOL1
19451649 Inhibition of endocytosis by siRNA-mediated depletion of EPS15, STX7, RAB7, and VAMP7 restores Gag/p24 expression in the presence of APOL1

AA Sequence

MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERF      1 - 70
RSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQG     71 - 140
WCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC               141 - 199
//

Text Mined References (13)

PMID Year Title
25996526 2015 Trichuris suis soluble products induce Rab7b expression and limit TLR4 responses in human dendritic cells.
23345514 2013 Identification of a role for the trans-Golgi network in human papillomavirus 16 pseudovirus infection.
22708738 2012 Dynamics of Rab7b-dependent transport of sorting receptors.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
21057625 2010 Rab7b and receptors trafficking.
20953574 2011 Small Rab GTPase Rab7b promotes megakaryocytic differentiation by enhancing IL-6 production and STAT3-GATA-1 association.
20375062 2010 Rab7b controls trafficking from endosomes to the TGN.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144907 2004 Rab7b, a novel lysosome-associated small GTPase, is involved in monocytic differentiation of human acute promyelocytic leukemia cells.
More...