Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 4.92

Knowledge Summary

Patent

No data available

TINX Plot

Protein-protein Interaction (5)

Gene RIF (9)

AA Sequence

MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERF      1 - 70
RSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQG     71 - 140
WCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC               141 - 199
//

Text Mined References (13)

PMID Year Title