Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.84
PubTator Score 3.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.065 1.3e-04
Atopic dermatitis 1.400 7.6e-04
Breast cancer 3.600 4.4e-02
cystic fibrosis 1.100 1.4e-02
gastric carcinoma 1.500 1.4e-02
group 4 medulloblastoma -1.200 1.3e-04
hepatocellular carcinoma 1.300 4.1e-04
interstitial cystitis 1.300 1.0e-02
intraductal papillary-mucinous neoplasm ... 1.800 3.7e-02
juvenile dermatomyositis 1.057 1.0e-05
lung cancer -2.300 4.4e-04
lung carcinoma -3.300 6.3e-31
malignant mesothelioma -2.800 3.1e-07
osteosarcoma -1.615 7.5e-03
ovarian cancer -1.300 5.7e-06
pituitary cancer -1.300 3.7e-03
primary Sjogren syndrome 1.800 1.4e-03
psoriasis 1.300 1.4e-33
subependymal giant cell astrocytoma 1.579 3.5e-02
tuberculosis -1.400 1.1e-03
ulcerative colitis 1.300 3.4e-04

Synonym

Accession Q96AH0 Q658Y8 Q9H5X6
Symbols SSB2
OBFC2A
SOSS-B2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGD      1 - 70
IIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNM     71 - 140
GTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR          141 - 204
//

Text Mined References (12)

PMID Year Title