Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.38
PubTator Score 3.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.39756657608366E-59
lung carcinoma 2844 6.27593590593763E-31
malignant mesothelioma 3163 3.08906703827708E-7
lung cancer 4473 5.19999986951239E-7
juvenile dermatomyositis 1189 1.01701723611279E-5
tuberculosis and treatment for 6 months 686 3.18779188086857E-5
group 4 medulloblastoma 1875 3.60441352189949E-5
ovarian cancer 8492 4.48606031049362E-5
acute quadriplegic myopathy 1157 1.28012067437646E-4
ulcerative colitis 2087 3.43825939672903E-4
hepatocellular carcinoma 550 4.47368750760116E-4
Atopic dermatitis 944 8.06887737433105E-4
primary Sjogren syndrome 789 0.00136102620721266
pituitary cancer 1972 0.00373930769424698
osteosarcoma 7933 0.00748887449153883
interstitial cystitis 2299 0.0102273448121629
cystic fibrosis 1670 0.0144216350204374
gastric carcinoma 832 0.0187224221788745
subependymal giant cell astrocytoma 2287 0.0354933727615891
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0367692414222006
Breast cancer 3099 0.0441920187524536
Disease Target Count
Acute Promyelocytic Leukemia 32

Expression

  Differential Expression (21)

Disease log2 FC p
hepatocellular carcinoma 1.400 0.000
malignant mesothelioma -2.800 0.000
osteosarcoma -1.615 0.007
juvenile dermatomyositis 1.057 0.000
acute quadriplegic myopathy 1.065 0.000
Atopic dermatitis 1.500 0.001
tuberculosis and treatment for 6 months -2.300 0.000
intraductal papillary-mucinous neoplasm ... 1.800 0.037
lung cancer -4.000 0.000
Breast cancer 3.600 0.044
interstitial cystitis 1.300 0.010
cystic fibrosis 1.100 0.014
group 4 medulloblastoma -1.300 0.000
primary Sjogren syndrome 1.800 0.001
psoriasis 1.600 0.000
subependymal giant cell astrocytoma 1.579 0.035
lung carcinoma -3.300 0.000
gastric carcinoma 1.700 0.019
ulcerative colitis 1.300 0.000
ovarian cancer 3.000 0.000
pituitary cancer -1.300 0.004

Synonym

Accession Q96AH0 Q658Y8 Q9H5X6
Symbols SSB2
OBFC2A
SOSS-B2

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
19605351 hSSB1 and hSSB2 form two separate complexes with similar structures, and both complexes participate in DNA damage response.

AA Sequence

MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGD      1 - 70
IIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNM     71 - 140
GTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR          141 - 204
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23266556 2013 Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.
19683501 2009 SOSS complexes participate in the maintenance of genomic stability.
19605351 2009 HSSB1 and hSSB2 form similar multiprotein complexes that participate in DNA damage response.
18449195 2008 Single-stranded DNA-binding protein hSSB1 is critical for genomic stability.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...