Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.61
PubTator Score 18.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer 1.100 4.1e-05
breast carcinoma 1.600 1.5e-04
glioblastoma 1.300 5.9e-03
invasive ductal carcinoma 1.900 7.2e-04
lung adenocarcinoma 1.300 3.8e-12
lung cancer 1.200 1.2e-02
medulloblastoma, large-cell 1.200 1.4e-04
Multiple myeloma 1.210 5.2e-03
non diabetic and post-ischemic heart fai... -1.200 7.9e-03
ovarian cancer 3.200 1.4e-06
pancreatic cancer -1.800 8.1e-04
primary pancreatic ductal adenocarcinoma -1.537 1.5e-03
psoriasis 1.100 1.6e-03

Gene RIF (4)

AA Sequence

MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKLTTLPSDFCGLTHLVKLDLS      1 - 70
KNKLQQLPADFGRLVNLQHLDLLNNKLVTLPVSFAQLKNLKWLDLKDNPLDPVLAKVAGDCLDEKQCKQC     71 - 140
ANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQRAKEAQERELRKREKAEEKERRRKEYDALKAAK    141 - 210
REQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKLLLLLLLFGVAGGLVACRVTELQQQPLCTSV    211 - 280
NTIYDNAVQGLRRHEILQWVLQTDSQQ                                               281 - 307
//

Text Mined References (24)

PMID Year Title