Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.61
PubTator Score 18.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
lung adenocarcinoma 2714 3.77969905524662E-12
ovarian cancer 8492 1.44763254302609E-6
medulloblastoma, large-cell 6234 1.370725503479E-4
breast carcinoma 1614 1.46776068881797E-4
invasive ductal carcinoma 2950 7.24317019651832E-4
pancreatic cancer 2300 8.06209571696185E-4
primary pancreatic ductal adenocarcinoma 1271 0.00147482153440063
psoriasis 6685 0.0016349414900064
Multiple myeloma 1328 0.00521557455875956
glioblastoma 5572 0.00593028867921774
non diabetic and post-ischemic heart failure 200 0.00789698187648705
lung cancer 4473 0.0124348417726133
inflammatory breast cancer 404 0.0134515311440761

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.210 0.005
psoriasis 1.100 0.002
glioblastoma 1.300 0.006
non diabetic and post-ischemic heart fai... -1.200 0.008
medulloblastoma, large-cell 1.200 0.000
primary pancreatic ductal adenocarcinoma -1.537 0.001
lung cancer 1.200 0.012
breast carcinoma 1.600 0.000
lung adenocarcinoma 1.300 0.000
inflammatory breast cancer 1.100 0.013
invasive ductal carcinoma 1.900 0.001
ovarian cancer 3.200 0.000
pancreatic cancer -1.800 0.001

Synonym

Accession Q96AG4 B2RE83 D3DTX8 Q9P189
Symbols p34
PRO1855

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
26466955 Endosomal localization of endogenous TLR3 was decreased by silencing of LRRC59, suggesting that LRRC59 promotes UNC93B1-mediated translocation of NA-sensing TLRs from the ER upon infection.
25833693 we provide a novel therapeutic mechanism for inhibiting CIP2A function in cancerous cells via targeting the CIP2A-LRRC59 interaction.
23125841 Tandem affinity purification and mass spectrometry analysis identify leucine rich repeat containing 59 (LRRC59), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22321063 LRRC59 facilitates transport of cytosolic FGF1 through nuclear pores by interaction with Kpns and movement of LRRC59 along the ER and NE membranes

AA Sequence

MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKLTTLPSDFCGLTHLVKLDLS      1 - 70
KNKLQQLPADFGRLVNLQHLDLLNNKLVTLPVSFAQLKNLKWLDLKDNPLDPVLAKVAGDCLDEKQCKQC     71 - 140
ANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQRAKEAQERELRKREKAEEKERRRKEYDALKAAK    141 - 210
REQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKLLLLLLLFGVAGGLVACRVTELQQQPLCTSV    211 - 280
NTIYDNAVQGLRRHEILQWVLQTDSQQ                                               281 - 307
//

Text Mined References (23)

PMID Year Title
26466955 2015 LRRC59 Regulates Trafficking of Nucleic Acid-Sensing TLRs from the Endoplasmic Reticulum via Association with UNC93B1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25833693 2015 Leucine-rich repeat-containing protein 59 mediates nuclear import of cancerous inhibitor of PP2A in prostate cancer cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22321063 2012 Nuclear import of exogenous FGF1 requires the ER-protein LRRC59 and the importins Kpn?1 and Kpn?1.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
More...