Property Summary

NCBI Gene PubMed Count 23
PubMed Score 288.76
PubTator Score 2.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Alzheimer's disease -1.200 3.0e-02
atypical teratoid / rhabdoid tumor -1.600 6.2e-07
hereditary spastic paraplegia -1.139 4.0e-03
Multiple myeloma 1.745 1.7e-03
ovarian cancer -1.700 6.9e-05
pancreatic ductal adenocarcinoma liver m... -1.552 2.8e-02
Pick disease -1.500 3.2e-05
progressive supranuclear palsy -1.400 2.3e-02

Gene RIF (11)

AA Sequence

MHPRRPDGFDGLGYRGGARDEQGFGGAFPARSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTS      1 - 70
TPYEGPTEEPFSSGGGGSVQGQSSEQLNRFAGFGIGLASLFTENVLAHPCIVLRRQCQVNYHAQHYHLTP     71 - 140
FTVINIMYSFNKTQGPRALWKGMGSTFIVQGVTLGAEGIISEFTPLPREVLHKWSPKQIGEHLLLKSLTY    141 - 210
VVAMPFYSASLIETVQSEIIRDNTGILECVKEGIGRVIGMGVPHSKRLLPLLSLIFPTVLHGVLHYIISS    211 - 280
VIQKFVLLILKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTII    281 - 350
DNTDLGYEVLPINTQYEGMRDCINTIRQEEGVFGFYKGFGAVIIQYTLHAAVLQITKIIYSTLLQNNI      351 - 418
//

Text Mined References (29)

PMID Year Title