Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.92
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.300 4.4e-02
ependymoma 1.400 2.0e-02
intraductal papillary-mucinous adenoma (... 1.200 2.2e-04
intraductal papillary-mucinous carcinoma... -1.100 6.2e-03
oligodendroglioma 1.800 1.2e-03
osteosarcoma 1.313 2.6e-04
ovarian cancer -1.100 1.3e-05
pancreatic cancer -1.400 1.7e-03
primary pancreatic ductal adenocarcinoma -1.249 1.4e-02
progressive supranuclear palsy -1.200 2.8e-02

Gene RIF (2)

AA Sequence

MAAAVGVRGRYELPPCSGPGWLLSLSALLSVAARGAFATTHWVVTEDGKIQQQVDSPMNLKHPHDLVILM      1 - 70
RQEATVNYLKELEKQLVAQKIHIEENEDRDTGLEQRHNKEDPDCIKAKVPLGDLDLYDGTYITLESKDIS     71 - 140
PEDYIDTESPVPPDPEQPDCTKILELPYSIHAFQHLRGVQERVNLSAPLLPKEDPIFTYLSKRLGRSIDD    141 - 210
IGHLIHEGLQKNTSSWVLYNMASFYWRIKNEPYQVVECAMRALHFSSRHNKDIALVNLANVLHRAHFSAD    211 - 280
AAVVVHAALDDSDFFTSYYTLGNIYAMLGEYNHSVLCYDHALQARPGFEQAIKRKHAVLCQQKLEQKLEA    281 - 350
QHRSLQRTLNELKEYQKQHDHYLRQQEILEKHKLIQEEQILRNIIHETQMAKEAQLGNHQICRLVNQQHS    351 - 420
LHCQWDQPVRYHRGDIFENVDYVQFGEDSSTSSMMSVNFDVQSNQSDINDSVKSSPVAHSILWIWGRDSD    421 - 490
AYRDKQHILWPKRADCTESYPRVPVGGELPTYFLPPENKGLRIHELSSDDYSTEEEAQTPDCSITDFRKS    491 - 560
HTLSYLVKELEVRMDLKAKMPDDHARKILLSRINNYTIPEEEIGSFLFHAINKPNAPIWLILNEAGLYWR    561 - 630
AVGNSTFAIACLQRALNLAPLQYQDVPLVNLANLLIHYGLHLDATKLLLQALAINSSEPLTFLSLGNAYL    631 - 700
ALKNISGALEAFRQALKLTTKCPECENSLKLIRCMQFYPFLYNITSSVCSGTVVEESNGSDEMENSDETK    701 - 770
MSEEILALVDEFQQAWPLEGFGGALEMKGRRLDLQGIRVLKKGPQDGVARSSCYGDCRSEDDEATEWITF    771 - 840
QVKRVKKPKGDHKKTPGKKVETGQIENGHRYQANLEITGPKVASPGPQGKKRDYQRLGWPSPDECLKLRW    841 - 910
VELTAIVSTWLAVSSKNIDITEHIDFATPIQQPAMEPLCNGNLPTSMHTLDHLHGVSNRASLHYTGESQL    911 - 980
TEVLQNLGKDQYPQQSLEQIGTRIAKVLEKNQTSWVLSSMAALYWRVKGQGKKAIDCLRQALHYAPHQMK    981 - 1050
DVPLISLANILHNAKLWNDAVIVATMAVEIAPHFAVNHFTLGNVYVAMEEFEKALVWYESTLKLQPEFVP   1051 - 1120
AKNRIQTIQCHLMLKKGRRSP                                                    1121 - 1141
//

Text Mined References (9)

PMID Year Title