Property Summary

NCBI Gene PubMed Count 60
PubMed Score 39.74
PubTator Score 44.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.300 2.8e-10
Amyotrophic lateral sclerosis 1.149 2.7e-06
breast carcinoma 1.300 7.6e-04
group 3 medulloblastoma 1.500 4.6e-04
intraductal papillary-mucinous adenoma (... 1.300 2.2e-02
intraductal papillary-mucinous carcinoma... 1.700 6.0e-03
intraductal papillary-mucinous neoplasm ... 2.200 1.2e-02
malignant mesothelioma 1.100 1.6e-06
osteosarcoma -1.067 2.2e-03
Pick disease -1.900 3.4e-05
progressive supranuclear palsy -2.100 5.3e-03
psoriasis -1.400 4.1e-07

Gene RIF (36)

AA Sequence

MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDG      1 - 70
DQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDS     71 - 140
GGLPERSCMLTGTPESVQSAKRLLDQIVEKGRPAPGFHHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQ    141 - 210
LQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGIDV    211 - 280
PIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGN    281 - 350
PGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNA    351 - 420
DPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTPMGPYNPAPYN    421 - 490
PGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAP    491 - 560
TTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTS    561 - 630
PQGMPQHPPAPQGQ                                                            631 - 644
//

Text Mined References (70)

PMID Year Title