Property Summary

NCBI Gene PubMed Count 53
PubMed Score 33.36
PubTator Score 44.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96AE4 Q12828 FBP
Symbols FBP
FUBP
hDH V

Gene

PDB

2KXH   1J4W   4LIJ  

Gene RIF (30)

PMID Text
26901106 direct connection between the cellular PI3K/AKT/mTOR signaling pathway, frequently activated in human hepatocarcinogenesis, and the enrichment of oncogenic transcription factors of the FBP family
26545048 With the advent of large-scale genome sequencing technology, molecular genetic alterations in FUBP1 promoter have now been identified in the majority of oligodendrogliomas
26177862 Concomitant overexpression of far upstream element (FUSE) binding protein (FBP) interacting repressor (FIR) and its splice variants induce migration and invasion of non-small cell lung cancer cells.
25995247 FBP1 promotes hepatitis C virus eplication by inhibiting p53 expression.
24966911 Apoptosis-mediated cleavage of FBP1 and its decreased expression in epithelial cells induces cell cycle arrest, which may play an important role in colonic epithelial disruption in colitis.
24798327 These findings are the first report describing the regulation of alternative splicing of MDM2 mediated by the oncogenic factor FUBP1.
24347226 High FBP1 expression was observed in glioma.
24192769 FUBP1 expression differs among gastric tissues; there is a correlation between overall survival rates and age, sex, lymph node metastasis, and distant metastasis.
24117486 The data indicates an association between FUBP1 expression and proliferation in gliomas.
24030748 We conclude that absent CIC and FUBP1 expressions are potential markers of shorter time to recurrence in oligodendroglial tumors.
More...

AA Sequence

MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDG      1 - 70
DQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDS     71 - 140
GGLPERSCMLTGTPESVQSAKRLLDQIVEKGRPAPGFHHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQ    141 - 210
LQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGIDV    211 - 280
PIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGN    281 - 350
PGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNA    351 - 420
DPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTPMGPYNPAPYN    421 - 490
PGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAP    491 - 560
TTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTS    561 - 630
PQGMPQHPPAPQGQ                                                            631 - 644
//

Text Mined References (63)

PMID Year Title
26901106 2016 PI3K/AKT/mTOR-dependent stabilization of oncogenic far-upstream element binding proteins in hepatocellular carcinoma cells.
26545048 2015 Molecular background of oligodendroglioma: 1p/19q, IDH, TERT, CIC and FUBP1.
26177862 2015 Concomitant expression of far upstream element (FUSE) binding protein (FBP) interacting repressor (FIR) and its splice variants induce migration and invasion of non-small cell lung cancer (NSCLC) cells.
25995247 2015 FUSE Binding Protein 1 Facilitates Persistent Hepatitis C Virus Replication in Hepatoma Cells by Regulating Tumor Suppressor p53.
24966911 2014 Role of far upstream element binding protein 1 in colonic epithelial disruption during dextran sulphate sodium-induced murine colitis.
24798327 2014 The splicing factor FUBP1 is required for the efficient splicing of oncogene MDM2 pre-mRNA.
24347226 2015 Expression of far upstream element (FUSE) binding protein 1 in human glioma is correlated with c-Myc and cell proliferation.
24192769 2013 Far upstream element-binding protein 1 (FUBP1) is overexpressed in human gastric cancer tissue compared to non-cancerous tissue.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24117486 2014 Loss of FUBP1 expression in gliomas predicts FUBP1 mutation and is associated with oligodendroglial differentiation, IDH1 mutation and 1p/19q loss of heterozygosity.
More...