Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.34
PubTator Score 0.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.100 4.2e-05
astrocytoma -1.100 1.3e-11
Astrocytoma, Pilocytic -2.500 2.4e-09
atypical teratoid / rhabdoid tumor -2.400 6.8e-07
Breast cancer 1.900 1.5e-15
breast carcinoma 1.200 5.1e-28
ependymoma -2.000 4.6e-11
glioblastoma -2.200 3.7e-09
group 3 medulloblastoma -2.100 3.0e-04
invasive ductal carcinoma 2.200 1.2e-03
medulloblastoma, large-cell -2.600 6.5e-05
oligodendroglioma -1.300 8.2e-11
osteosarcoma -1.317 1.5e-03
pancreatic ductal adenocarcinoma liver m... 1.124 3.1e-03
Pick disease -2.500 8.1e-06
primitive neuroectodermal tumor -1.600 5.8e-03
subependymal giant cell astrocytoma -2.210 4.6e-02

Gene RIF (1)

AA Sequence

MYAFYSLLIYIFYSLFRRDGGAAAAAEPGDPAQRARKPRGRRRPDLPAPELWTELTGLAASSEPEDGSEG      1 - 70
AAEGRAAAVSLEEALLRLAEFLSVQLGAEESCGGPADLGQSGEVPSLLTVTSQLLALLAWLRSPRGRQAL     71 - 140
LQGTQPAPRVRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLEQLILGQLEELK    141 - 210
QQLEQQEEELGRLRLGVGATDSEKRVQHLTLENEALKQSLSLMRDLLLHWGPGPPIRAPQEEAEALLELQ    211 - 280
GRLQEAQDTTEALRAQLGVQEVQLQGLQGALQQLQQETEQNCRRELQQMHGQLAGLRARMASLRQGCGDL    281 - 350
RGLVSTFTQSCQGSLSEARGQVSWALGALSSGGPGTQLPEGQQGPPAGCPGRLPELKGNIRVLCRLRPGT    351 - 420
SSSLVSVEPGPGGTVTTCYRGRHRRFRLDWVFPPDASQEEVFRELEPAVLSCLRGYSVCIFTYGQTGTGK    421 - 490
TYSMEGPPEDPGIVPRALQSLFREMGAGRQHRVTLSMVEIYNEAVRDLLAPGPPERLAVRQGPEGQGGIQ    491 - 560
VAGLTHWDVPNLETLHQMLKLGRSNRATAATAMNQRSSRSHALVTLTLRAASPPRAPGTAGTLHLVDLAG    561 - 630
SERARKAGAAGPPRGDPDGARRLREAQTINRSLLALGGVMAALRAHRPHVPFRDSQLTRLLQPALGPGTT    631 - 700
AVLLLQVGAGAGQVCACRSPPTRARPPAPLARRSPRGRRISGRQSAPSSSPTEWVKWSWGQPGAAGSRAP    701 - 770
PGRLLPSAPTLRSPGPPAPLRRPLAVLHAPVPTTARARLSRPQRACPSSPGSRPCPWGLRPGLCWQRR      771 - 838
//

Text Mined References (10)

PMID Year Title