Property Summary

NCBI Gene PubMed Count 54
PubMed Score 85.70
PubTator Score 63.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (27)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 3.3e-04
Atopic dermatitis -1.400 1.7e-03
Breast cancer -1.500 1.5e-07
breast carcinoma -1.200 8.7e-04
colon cancer -2.600 2.6e-02
cystic fibrosis -1.699 8.2e-05
dermatomyositis 1.400 8.5e-04
Down syndrome 1.600 7.3e-04
ductal carcinoma in situ -2.000 1.3e-03
fibroadenoma -1.400 3.9e-02
intraductal papillary-mucinous adenoma (... -1.200 2.2e-03
intraductal papillary-mucinous carcinoma... -1.500 7.8e-04
intraductal papillary-mucinous neoplasm ... -1.500 5.6e-03
invasive ductal carcinoma -1.900 1.5e-02
lung adenocarcinoma -1.200 6.1e-13
lung cancer -1.200 4.7e-02
lung carcinoma -1.200 2.8e-10
medulloblastoma, large-cell -1.100 2.0e-03
non-small cell lung cancer -1.173 2.0e-07
osteosarcoma 2.410 2.1e-04
ovarian cancer -1.500 9.3e-07
pancreatic cancer 1.200 4.2e-02
pancreatic ductal adenocarcinoma liver m... -1.068 4.6e-03
pituitary cancer -1.100 7.1e-06
psoriasis -1.100 2.8e-03
tuberculosis -1.100 2.8e-05
ulcerative colitis 2.300 5.6e-05

Protein-protein Interaction (1)

Gene RIF (40)

AA Sequence

MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRT      1 - 70
WLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL     71 - 140
LKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGD    141 - 210
SALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFF    211 - 280
DLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAAL    281 - 350
SDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ    351 - 420
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQ    421 - 490
NILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQ    491 - 560
AWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFAD    561 - 630
EVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV                        631 - 680
//

Text Mined References (65)

PMID Year Title