Property Summary

NCBI Gene PubMed Count 48
PubMed Score 71.99
PubTator Score 63.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
breast carcinoma 1614 4.15378046764621E-17
lung adenocarcinoma 2714 4.34539050106474E-17
non-small cell lung cancer 2798 1.49723032692907E-14
lung carcinoma 2844 2.81538719239299E-10
ovarian cancer 8492 9.72851045742395E-9
Breast cancer 3099 1.53761517867956E-7
psoriasis 6685 1.22675060677975E-6
tuberculosis 1563 2.84913741692316E-5
ulcerative colitis 2087 5.57299019859162E-5
cystic fibrosis 1670 8.17244346123809E-5
osteosarcoma 7933 2.12603633019339E-4
pituitary cancer 1972 2.71334487239828E-4
pilocytic astrocytoma 3086 3.39294410728096E-4
Down syndrome 548 7.29334882920576E-4
dermatomyositis 967 8.495461032455E-4
colon cancer 1475 9.95617867884927E-4
medulloblastoma, large-cell 6234 0.00131061753488932
ductal carcinoma in situ 1745 0.00131762187724392
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00135868687098329
primary pancreatic ductal adenocarcinoma 1271 0.00141821602692593
Atopic dermatitis 944 0.0016549550992961
pancreatic cancer 2300 0.00171122909413995
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00197754691830253
invasive ductal carcinoma 2950 0.00280616045363598
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0112741201181518
fibroadenoma 557 0.0394774461894451
lung cancer 4473 0.0467860062893646
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 2.0
Disease Target Count Z-score Confidence
Kindler syndrome 10 6.087 3.0
Leukocyte adhesion deficiency 15 3.687 1.8

Expression

  Differential Expression (27)

Disease log2 FC p
psoriasis -1.400 0.000
osteosarcoma 2.410 0.000
cystic fibrosis -1.699 0.000
medulloblastoma, large-cell -1.200 0.001
Atopic dermatitis -1.400 0.002
tuberculosis -1.100 0.000
primary pancreatic ductal adenocarcinoma 1.786 0.001
non-small cell lung cancer -1.534 0.000
intraductal papillary-mucinous adenoma (... -3.000 0.002
intraductal papillary-mucinous carcinoma... -3.800 0.001
intraductal papillary-mucinous neoplasm ... -3.700 0.011
lung cancer -1.200 0.047
colon cancer -2.700 0.001
breast carcinoma -1.300 0.000
fibroadenoma -1.400 0.039
lung adenocarcinoma -1.400 0.000
pilocytic astrocytoma 1.100 0.000
lung carcinoma -1.200 0.000
Breast cancer -1.500 0.000
ductal carcinoma in situ -2.000 0.001
invasive ductal carcinoma -2.300 0.003
ulcerative colitis 2.300 0.000
ovarian cancer -3.000 0.000
pituitary cancer -1.200 0.000
Down syndrome 1.600 0.001
pancreatic cancer 1.700 0.002
dermatomyositis 1.400 0.001

Synonym

Accession Q96AC1 B5TJY2 Q14840 Q86TY7
Symbols MIG2
KIND2
mig-2
UNC112
PLEKHC1
UNC112B

Gene

PDB

2LGX   2LKO   2MSU   4F7H  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (34)

PMID Text
27044892 The F0 domain of K2 binds actin.
26551397 data indicate that kindlin-2 promotes the invasiveness of prostate cancer cells largely through NF-kappaB-dependent upregulation of MMP-9 and MMP-2
26037143 findings suggest that Src, Kindlin-2 and Migfilin together constitute a positive feedback loop that controls Src activity and regulates integrin-mediated cellular func
25618552 our findings suggested that Kindlin-2 was highly expressed in hepatocellular carcinoma tissues and was closely related to clinical progression. Kindlin-2 protein could be a potential biomarker for predicting poor prognosis of HCC patients after surgery.
25605255 High kindlin-2 expression is associated with esophageal squamous cell carcinoma.
25160619 A major ILK binding site in the kindlin-2 FERM domain for regulating cell adhesion has been mapped.
24907935 Data indicate that Kindlin-2 mRNA levels in adult is highly expressed in mesoderm-derived organs.
24599960 the first evidence that interaction between the integrin beta1 cytoplasmic tail and kindlin-2, a member of a family of adapters implicated in human disease pathogenesis, is mainly governed by the beta1 C-terminal carboxylate moiety
23857544 Kindlin-2 might promote the invasion of gastric cancer cells through enhancing proliferation and adhesion by the phosphorylation of integrin beta1 and beta3.
23723426 Kindlin-2 mediates activation of TGF-beta/Smad signaling and renal fibrosis.
More...

AA Sequence

MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRT      1 - 70
WLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL     71 - 140
LKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGD    141 - 210
SALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFF    211 - 280
DLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAAL    281 - 350
SDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ    351 - 420
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQ    421 - 490
NILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQ    491 - 560
AWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFAD    561 - 630
EVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV                        631 - 680
//

Text Mined References (59)

PMID Year Title
27044892 2016 Kindlin-2 directly binds actin and regulates integrin outside-in signaling.
26551397 2016 Kindlin-2 promotes invasiveness of prostate cancer cells via NF-?B-dependent upregulation of matrix metalloproteinases.
26037143 2015 Kindlin-2 phosphorylation by Src at Y193 enhances Src activity and is involved in Migfilin recruitment to the focal adhesions.
25646088 2015 Dense fibrillar collagen is a potent inducer of invadopodia via a specific signaling network.
25618552 2015 Kindlin-2: a novel prognostic biomarker for patients with hepatocellular carcinoma.
25605255 2015 A three-protein signature and clinical outcome in esophageal squamous cell carcinoma.
25160619 2014 Molecular basis of kindlin-2 binding to integrin-linked kinase pseudokinase for regulating cell adhesion.
24907935 2014 Kindlin-2 expression in adult tissues correlates with their embryonic origins.
24599960 2014 C-terminal COOH of integrin ?1 is necessary for ?1 association with the kindlin-2 adapter protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...