Property Summary

NCBI Gene PubMed Count 48
Grant Count 39
R01 Count 23
Funding $4,606,956.2
PubMed Score 71.99
PubTator Score 63.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
psoriasis -1.400 0.000
osteosarcoma 2.410 0.000
cystic fibrosis -1.699 0.000
medulloblastoma, large-cell -1.200 0.001
Atopic dermatitis -1.400 0.002
tuberculosis -1.100 0.000
primary pancreatic ductal adenocarcinoma 1.786 0.001
non-small cell lung cancer -1.534 0.000
intraductal papillary-mucinous adenoma (... -3.000 0.002
intraductal papillary-mucinous carcinoma... -3.800 0.001
intraductal papillary-mucinous neoplasm ... -3.700 0.011
lung cancer -1.200 0.047
colon cancer -2.700 0.001
breast carcinoma -1.300 0.000
fibroadenoma -1.400 0.039
lung adenocarcinoma -1.400 0.000
pilocytic astrocytoma 1.100 0.000
lung carcinoma -1.200 0.000
Breast cancer -1.500 0.000
ductal carcinoma in situ -2.000 0.001
invasive ductal carcinoma -2.300 0.003
ulcerative colitis 2.300 0.000
ovarian cancer -3.000 0.000
pituitary cancer -1.200 0.000
Down syndrome 1.600 0.001
pancreatic cancer 1.700 0.002
dermatomyositis 1.400 0.001

Gene RIF (34)

PMID Text
27044892 The F0 domain of K2 binds actin.
26551397 data indicate that kindlin-2 promotes the invasiveness of prostate cancer cells largely through NF-kappaB-dependent upregulation of MMP-9 and MMP-2
26037143 findings suggest that Src, Kindlin-2 and Migfilin together constitute a positive feedback loop that controls Src activity and regulates integrin-mediated cellular func
25618552 our findings suggested that Kindlin-2 was highly expressed in hepatocellular carcinoma tissues and was closely related to clinical progression. Kindlin-2 protein could be a potential biomarker for predicting poor prognosis of HCC patients after surgery.
25605255 High kindlin-2 expression is associated with esophageal squamous cell carcinoma.
25160619 A major ILK binding site in the kindlin-2 FERM domain for regulating cell adhesion has been mapped.
24907935 Data indicate that Kindlin-2 mRNA levels in adult is highly expressed in mesoderm-derived organs.
24599960 the first evidence that interaction between the integrin beta1 cytoplasmic tail and kindlin-2, a member of a family of adapters implicated in human disease pathogenesis, is mainly governed by the beta1 C-terminal carboxylate moiety
23857544 Kindlin-2 might promote the invasion of gastric cancer cells through enhancing proliferation and adhesion by the phosphorylation of integrin beta1 and beta3.
23723426 Kindlin-2 mediates activation of TGF-beta/Smad signaling and renal fibrosis.
More...

AA Sequence

MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRT      1 - 70
WLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL     71 - 140
LKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGD    141 - 210
SALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFF    211 - 280
DLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAAL    281 - 350
SDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ    351 - 420
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQ    421 - 490
NILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQ    491 - 560
AWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFAD    561 - 630
EVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV                        631 - 680
//

Text Mined References (59)

PMID Year Title
27044892 2016 Kindlin-2 directly binds actin and regulates integrin outside-in signaling.
26551397 2016 Kindlin-2 promotes invasiveness of prostate cancer cells via NF-?B-dependent upregulation of matrix metalloproteinases.
26037143 2015 Kindlin-2 phosphorylation by Src at Y193 enhances Src activity and is involved in Migfilin recruitment to the focal adhesions.
25646088 2015 Dense fibrillar collagen is a potent inducer of invadopodia via a specific signaling network.
25618552 2015 Kindlin-2: a novel prognostic biomarker for patients with hepatocellular carcinoma.
25605255 2015 A three-protein signature and clinical outcome in esophageal squamous cell carcinoma.
25160619 2014 Molecular basis of kindlin-2 binding to integrin-linked kinase pseudokinase for regulating cell adhesion.
24907935 2014 Kindlin-2 expression in adult tissues correlates with their embryonic origins.
24599960 2014 C-terminal COOH of integrin ?1 is necessary for ?1 association with the kindlin-2 adapter protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...