Property Summary

NCBI Gene PubMed Count 10
PubMed Score 162.29
PubTator Score 65.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.77462822496747E-9
psoriasis 6685 1.34542253279369E-7
osteosarcoma 7933 4.16690088705971E-6
medulloblastoma, large-cell 6234 5.26121778308405E-4
group 4 medulloblastoma 1875 5.53977847140021E-4
dermatomyositis 967 0.0028376945421357
astrocytic glioma 2241 0.00387174358988404
oligodendroglioma 2849 0.00707062063814872
ependymoma 2514 0.00873833303616752
subependymal giant cell astrocytoma 2287 0.019461017748449
Multiple myeloma 1328 0.0402503362368339
Disease Target Count Z-score Confidence
Tendinitis 13 3.035 1.5

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.179 0.040
astrocytic glioma -1.400 0.004
ependymoma -1.500 0.009
oligodendroglioma -1.400 0.007
psoriasis -1.300 0.000
osteosarcoma -1.535 0.000
medulloblastoma, large-cell -1.600 0.001
group 4 medulloblastoma -1.300 0.001
subependymal giant cell astrocytoma 1.516 0.019
ovarian cancer -2.100 0.000
dermatomyositis 1.100 0.003

Synonym

Accession Q96AB6 Q7Z4Z0
Symbols PNAA
PNAD

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
21375249 Results indicate that hNTAN1 is highly selective for the hydrolysis of N-terminal peptidyl L-Asn.
18496130 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSD      1 - 70
DATTCHIVVLRHTGNGATCLTHCDGTDTKAEVPLIMNSIKSFSDHAQCGRLEVHLVGGFSDDRQLSQKLT     71 - 140
HQLLSEFDRQEDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGPEEQLRAARTLA    141 - 210
GGPMISIYDAETEQLRIGPYSWTPFPHVDFWLHQDDKQILENLSTSPLAEPPHFVEHIRSTLMFLKKHPS    211 - 280
PAHTLFSGNKALLYKKNEDGLWEKISSPGS                                            281 - 310
//

Text Mined References (10)

PMID Year Title
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24816252 2014 An atlas of genetic influences on human blood metabolites.
21375249 2011 Expression and biochemical characterization of the human enzyme N-terminal asparagine amidohydrolase.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
19786961 2011 Copy number variations of chromosome 16p13.1 region associated with schizophrenia.
18496130 2008 Genetic predictors of glucocorticoid-induced hypertension in children with acute lymphoblastic leukemia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.