Property Summary

NCBI Gene PubMed Count 10
PubMed Score 166.37
PubTator Score 65.62

Knowledge Summary


No data available


  Disease (2)


  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 3.9e-03
dermatomyositis 1.100 2.8e-03
ependymoma -1.500 8.7e-03
group 4 medulloblastoma -1.300 5.5e-04
medulloblastoma, large-cell -1.200 2.2e-03
Multiple myeloma 1.179 4.0e-02
oligodendroglioma -1.400 7.1e-03
osteosarcoma -1.535 4.2e-06
ovarian cancer -2.100 3.8e-09
psoriasis -1.300 1.3e-07
subependymal giant cell astrocytoma 1.516 1.9e-02


Accession Q96AB6 Q7Z4Z0
Symbols PNAA


PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

PAHTLFSGNKALLYKKNEDGLWEKISSPGS                                            281 - 310

Text Mined References (10)

PMID Year Title