Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 18.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Congenital Disorder Of Glycosylation, Type In 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 8.4e-05
ovarian cancer 8520 2.6e-04
pancreatic ductal adenocarcinoma liver metastasis 1962 2.9e-02
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 54 0.0 4.0
Disease Target Count
RFT1-CDG 1

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.508 8.4e-05
ovarian cancer 1.300 2.6e-04
pancreatic ductal adenocarcinoma liver m... -1.298 2.9e-02

Gene RIF (5)

AA Sequence

MGSQEVLGHAARLASSGLLLQVLFRLITFVLNAFILRFLSKEIVGVVNVRLTLLYSTTLFLAREAFRRAC      1 - 70
LSGGTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGVVLFGLSAVVELLGEPFW     71 - 140
VLAQAHMFVKLKVIAESLSVILKSVLTAFLVLWLPHWGLYIFSLAQLFYTTVLVLCYVIYFTKLLGSPES    141 - 210
TKLQTLPVSRITDLLPNITRNGAFINWKEAKLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDI    211 - 280
VNNLGSLVARLIFQPIEESFYIFFAKVLERGKDATLQKQEDVAVAAAVLESLLKLALLAGLTITVFGFAY    281 - 350
SQLALDIYGGTMLSSGSGPVLLRSYCLYVLLLAINGVTECFTFAAMSKEEVDRYNFVMLALSSSFLVLSY    351 - 420
LLTRWCGSVGFILANCFNMGIRITQSLCFIHRYYRRSPHRPLAGLHLSPVLLGTFALSGGVTAVSEVFLC    421 - 490
CEQGWPARLAHIAVGAFCLGATLGTAFLTETKLIHFLRTQLGVPRRTDKMT                       491 - 541
//

Text Mined References (16)

PMID Year Title