Property Summary

NCBI Gene PubMed Count 3
PubMed Score 9.97
PubTator Score 10.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Invasive lobular carcinoma 6 3.505 1.8

Expression

Gene RIF (1)

PMID Text
20357257 Study of long pentraxin PTX4 in silico and by transcript expression shows that the gene clusters alone in phylogenetic analysis, is well conserved from mammals to lower vertebrates, and has a unique pattern of messenger RNA expression.

AA Sequence

MGCSWRKTLSFFLVFVPIYLHGASSQEAAPVGPRKPFFERLRRLEEQFRRFQEVTWTHLQNIASNYNVSY      1 - 70
NVDVRFRSLAEESQAVAQAVNRSQASVQGELAQLKAWVRKLQRRGRKVDTRLRALDLTLGERSQQRARER     71 - 140
KAHKAQRDALQDSLARLEGLVHSQGARLAALEGRLPVAHPGTAALGPALVPTPTQPEELGPTSLKLQRDR    141 - 210
QELRAASEHRGPPQDSSAPLQGRREPPASGSHRVLSGTAPKDPRQQAWSPQVPGEICGVGPTLVFPNAST    211 - 280
RNVVFLSPGFVTALRALSFCSWVRTASGRLGTLLSYATEDNDNKLVLHGRDSLLPGSIHFVIGDPAFREL    281 - 350
PLQLLLDGQWHHICVIWTSTQGRYWLHVDRRLVATGSRFREGYEIPPGGSLVLGQEQDSVGGGFDSSEAF    351 - 420
VGSMSGLAIWDRALVPGEVANLAIGKEFPTGAILTLANAALAGGFVQGANCTCLERCP                421 - 478
//

Text Mined References (5)

PMID Year Title
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
20357257 2010 Evolution of the pentraxin family: the new entry PTX4.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.