Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 7.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -2.200 1.5e-04
Astrocytoma, Pilocytic -1.900 4.9e-06
ependymoma -2.100 5.0e-14
glioblastoma -2.000 3.0e-11
group 3 medulloblastoma -1.500 3.6e-02
medulloblastoma, large-cell -2.300 1.2e-04
non primary Sjogren syndrome sicca 1.400 1.4e-02
ovarian cancer -1.400 1.7e-06
primitive neuroectodermal tumor -1.400 7.0e-03

Gene RIF (3)

AA Sequence

MKLALLLPWACCCLCGSALATGFLYPFSAAALQQHGYPEPGAGSPGSGYASRRHWCHHTVTRTVSCQVQN      1 - 70
GSETVVQRVYQSCRWPGPCANLVSYRTLIRPTYRVSYRTVTVLEWRCCPGFTGSNCDEECMNCTRLSDMS     71 - 140
ERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVPRQRRPTGPAGPPGQTGPP    141 - 210
GPAGPPGSKGDRGQTGEKGPAGPPGLLGPPGPRGLPGEMGRPGPPGPPGPAGNPGPSPNSPQGALYSLQP    211 - 280
PTDKDNGDSRLASAIVDTVLAGVPGPRGPPGPPGPPGPRGPPGPPGTPGSQGLAGERGTVGPSGEPGVKG    281 - 350
EEGEKAATAEGEGVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKRGGAQPDGV    351 - 420
LAALLGPDPGQKSVDQASSRK                                                     421 - 441
//

Text Mined References (13)

PMID Year Title