Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 7.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -2.100 0.000
glioblastoma -2.200 0.000
group 3 medulloblastoma -1.500 0.036
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.400 0.007
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.900 0.000
non primary Sjogren syndrome sicca 1.400 0.014
ovarian cancer -1.400 0.000

Synonym

Accession Q96A83 Q32M90
Symbols EMI6
EMU2
SH2B
EMID2

Gene

PDB

4AU2   4AU3   4BJ3  

Gene RIF (3)

PMID Text
22217332 13 EMID2 variants were significantly associated with the presence of nasal polyps in the overall asthma group.
21086123 EMID2 may be a susceptible genetic factor for aspirin hypersensitivity among asthmatics in Korean population.
21086123 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MKLALLLPWACCCLCGSALATGFLYPFSAAALQQHGYPEPGAGSPGSGYASRRHWCHHTVTRTVSCQVQN      1 - 70
GSETVVQRVYQSCRWPGPCANLVSYRTLIRPTYRVSYRTVTVLEWRCCPGFTGSNCDEECMNCTRLSDMS     71 - 140
ERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVPRQRRPTGPAGPPGQTGPP    141 - 210
GPAGPPGSKGDRGQTGEKGPAGPPGLLGPPGPRGLPGEMGRPGPPGPPGPAGNPGPSPNSPQGALYSLQP    211 - 280
PTDKDNGDSRLASAIVDTVLAGVPGPRGPPGPPGPPGPRGPPGPPGTPGSQGLAGERGTVGPSGEPGVKG    281 - 350
EEGEKAATAEGEGVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKRGGAQPDGV    351 - 420
LAALLGPDPGQKSVDQASSRK                                                     421 - 441
//

Text Mined References (13)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
22760553 2012 Genome-wide pharmacogenomic study of citalopram-induced side effects in STAR*D.
22217332 2012 Possible role of EMID2 on nasal polyps pathogenesis in Korean asthma patients.
21948517 2011 Enhancer-adoption as a mechanism of human developmental disease.
21086123 2011 A possible association of EMID2 polymorphisms with aspirin hypersensitivity in asthma.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...