Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.200 1.1e-03
ovarian cancer -1.100 1.4e-03
primary pancreatic ductal adenocarcinoma 1.345 2.1e-03

Gene RIF (1)

AA Sequence

MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKV      1 - 70
EEGEASLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTT     71 - 140
EETKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDS    141 - 210
GSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVM    211 - 280
EGKKQPPRAHNLKPRDLNVLTPTGF                                                 281 - 305
//

Text Mined References (18)

PMID Year Title