Property Summary

NCBI Gene PubMed Count 14
PubMed Score 20.87
PubTator Score 12.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.225 1.3e-02
atypical teratoid/rhabdoid tumor 1.100 4.4e-07
Breast cancer -1.100 8.9e-22
glioblastoma 1.100 4.9e-05
group 3 medulloblastoma 1.100 9.1e-03
lung cancer 1.100 3.4e-03
malignant mesothelioma 1.500 9.1e-07
medulloblastoma, large-cell 1.100 7.7e-05
nasopharyngeal carcinoma 1.300 2.8e-04
ovarian cancer 1.300 1.5e-04
tuberculosis and treatment for 6 months 1.100 5.6e-04

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSE      1 - 70
ITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIG     71 - 140
LHFKIKPI                                                                  141 - 148
//

Text Mined References (18)

PMID Year Title