Property Summary

NCBI Gene PubMed Count 14
PubMed Score 20.19
PubTator Score 12.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
glioblastoma 1.100 0.000
medulloblastoma, large-cell 1.100 0.000
tuberculosis and treatment for 6 months 1.100 0.001
lung cancer 1.400 0.000
active Crohn's disease 1.225 0.013
atypical teratoid/rhabdoid tumor 1.100 0.000
group 3 medulloblastoma 1.100 0.009
nasopharyngeal carcinoma 1.300 0.000
Breast cancer -1.100 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q96A72
Symbols MGN2
mago
magoh

Gene

Gene RIF (3)

PMID Text
23917022 findings show 2 genes MAGOH and MAGOHB are expressed in mammals; in macrophages, expression of MAGOHB but not MAGOH mRNA increases after LPS stimulation; both MAGOH proteins interact with other exon junction complex (EJC) components, incorporate into mRNA-bound EJCs and activate nonsense-mediated decay
23166591 Expression of HIV-1 Tat downregulates the abundance of mago-nashi homolog B (MAGOHB) in the nucleoli of Jurkat T-cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSE      1 - 70
ITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIG     71 - 140
LHFKIKPI                                                                  141 - 148
//

Text Mined References (18)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24416299 2014 Slow co-evolution of the MAGO and Y14 protein families is required for the maintenance of their obligate heterodimerization mode.
23917022 2013 Two mammalian MAGOH genes contribute to exon junction complex composition and nonsense-mediated decay.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...