Property Summary

NCBI Gene PubMed Count 20
PubMed Score 97.57
PubTator Score 97.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 1.5e-03
atypical teratoid / rhabdoid tumor -1.500 3.2e-09
glioblastoma -1.100 4.9e-04
lung adenocarcinoma 1.200 9.1e-08
medulloblastoma, large-cell -1.700 2.2e-05
osteosarcoma 1.308 9.8e-05
primitive neuroectodermal tumor -1.100 2.2e-02

Gene RIF (7)

AA Sequence

MAGYLSESDFVMVEEGFSTRDLLKELTLGASQATTDEVAAFFVADLGAIVRKHFCFLKCLPRVRPFYAVK      1 - 70
CNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPASKIICANPCKQIAQIKYAAKHGIQLLSFDNEMEL     71 - 140
AKVVKSHPSAKMVLCIATDDSHSLSCLSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYA    141 - 210
QSIADARLVFEMGTELGHKMHVLDLGGGFPGTEGAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYY    211 - 280
VTSAFTVAVSIIAKKEVLLDQPGREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPILQKKPSTEQP    281 - 350
LYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSRVAWEALRR    351 - 420
QLMAAEQEDDVEGVCKPLSCGWEITDTLCVGPVFTPASIM                                  421 - 460
//

Text Mined References (20)

PMID Year Title