Property Summary

NCBI Gene PubMed Count 19
Grant Count 57
R01 Count 27
Funding $8,543,405.44
PubMed Score 94.47
PubTator Score 97.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.308 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.200 0.004
adult high grade glioma -1.100 0.001
lung adenocarcinoma 1.200 0.000

Synonym

Accession Q96A70 B2RDU5 D3DPQ9 Q5TIF4 Q5TIF5 Q5TIF6 Q8TF56 Q96L54 Q96L55 Q96L56 Q96L57 Q96MD9 AzI2
Symbols ADC
AZI2
ODCp
AZIB1
ODC-p
ODC1L

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
26963840 The high expression of AZIN2 in various cells with secretory or vesicle transport activity indicates that the polyamine metabolism regulated by AZIN2
20188728 Both endogenous and FLAG-tagged AZIN2 localize to post-Golgi vesicles of the secretory pathway. Immuno-electron microscopy revealed that the vesicles associate mainly with the trans-Golgi network.
20147969 Observational study of gene-disease association. (HuGE Navigator)
19956990 AZIN2 expression appears to be restricted to brain and testis and it is a labile protein degraded by a ubiquitin-dependent mechanism.
19832840 ODC activity is mostly linked to cell proliferation, whereas its regulation by AZIN2 in post-mitotically differentiated neurons of the brain apparently serves different purposes.
19756694 localization of AZIN2 implies possible involvement in the gonadal synthesis and/or release of steroid hormones.

AA Sequence

MAGYLSESDFVMVEEGFSTRDLLKELTLGASQATTDEVAAFFVADLGAIVRKHFCFLKCLPRVRPFYAVK      1 - 70
CNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPASKIICANPCKQIAQIKYAAKHGIQLLSFDNEMEL     71 - 140
AKVVKSHPSAKMVLCIATDDSHSLSCLSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYA    141 - 210
QSIADARLVFEMGTELGHKMHVLDLGGGFPGTEGAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYY    211 - 280
VTSAFTVAVSIIAKKEVLLDQPGREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPILQKKPSTEQP    281 - 350
LYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSRVAWEALRR    351 - 420
QLMAAEQEDDVEGVCKPLSCGWEITDTLCVGPVFTPASIM                                  421 - 460
//

Text Mined References (19)

PMID Year Title
26963840 2016 Expression of ODC Antizyme Inhibitor 2 (AZIN2) in Human Secretory Cells and Tissues.
25416956 2014 A proteome-scale map of the human interactome network.
24967154 2014 Structural and degradative aspects of ornithine decarboxylase antizyme inhibitor 2.
20217058 2010 Recurrent emergence of catalytically inactive ornithine decarboxylase homologous forms that likely have regulatory function.
20188728 2010 Ornithine decarboxylase antizyme inhibitor 2 regulates intracellular vesicle trafficking.
20147969 2010 Non-synonymous single-nucleotide polymorphisms associated with blood pressure and hypertension.
19956990 2010 Antizyme inhibitor 2: molecular, cellular and physiological aspects.
19832840 2010 Brain neurons express ornithine decarboxylase-activating antizyme inhibitor 2 with accumulation in Alzheimer's disease.
19756694 2009 High expression of antizyme inhibitor 2, an activator of ornithine decarboxylase in steroidogenic cells of human gonads.
19718454 2009 Expression of antizyme inhibitor 2 in mast cells and role of polyamines as selective regulators of serotonin secretion.
More...