Property Summary

NCBI Gene PubMed Count 42
Grant Count 19
R01 Count 5
Funding $853,616.64
PubMed Score 38.13
PubTator Score 23.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 2.500 0.005
ependymoma 2.600 0.005
oligodendroglioma 2.500 0.002
atypical teratoid / rhabdoid tumor 1.200 0.004
glioblastoma 1.200 0.009
group 4 medulloblastoma 1.600 0.000
medulloblastoma, large-cell 1.500 0.000
tuberculosis 1.500 0.000
ovarian cancer 1.200 0.001

Gene RIF (14)

PMID Text
26350970 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC4
26350970 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC4
26283729 Sec8 regulates histone-modifying proteins ATF2 and RNF20.
25725287 Sec8 knockdown in HSC3 cells resulted in reduced expressions of PAK1 and PAK2 by upregulating Pirh2 and Siah1 expression, which inhibited the ERK or p38 MAPK signalling pathway and cytokeratin8 phosphorylation and cell migration.
25244576 knockdown of Sec8 enhances the binding of JIP4 to MAPK kinase 4, thereby decreasing the phosphorylation of MAPK kinase 4, JNK, and p38.
23207790 High Sec8 expression is associated with progression of oral squamous-cell carcinoma by secretion of matrix metalloproteinases.
23169490 Exome sequencing revealed a likely pathogenic mutation in three novel candidate MKS disease genes-C5orf42, EVC2 and SEC8 (also known as EXOC4), which encodes an exocyst protein with an established role in ciliogenesis
22534017 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC4
22190034 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC4
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELT      1 - 70
TAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIEHKHVLNLLDEIENIKQVPQK     71 - 140
LEQCMASKHYLSATDMLVSAVESLEGPLLQVEGLSDLRLELHSKKMNLHLVLIDELHRHLYIKSTSRVVQ    141 - 210
RNKEKGKISSLVKDASVPLIDVTNLPTPRKFLDTSHYSTAGSSSVREINLQDIKEDLELDPEENSTLFMG    211 - 280
ILIKGLAKLKKIPETVKAIIERLEQELKQIVKRSTTQVADSGYQRGENVTVENQPRLLLELLELLFDKFN    281 - 350
AVAAAHSVVLGYLQDTVVTPLTQQEDIKLYDMADVWVKIQDVLQMLLTEYLDMKNTRTASEPSAQLSYAS    351 - 420
TGREFAAFFAKKKPQRPKNSLFKFESSSHAISMSAYLREQRRELYSRSGELQGGPDDNLIEGGGTKFVCK    421 - 490
PGARNITVIFHPLLRFIQEIEHALGLGPAKQCPLREFLTVYIKNIFLNQVLAEINKEIEGVTKTSDPLKI    491 - 560
LANADTMKVLGVQRPLLQSTIIVEKTVQDLLNLMHDLSAYSDQFLNMVCVKLQEYKDTCTAAYRGIVQSE    561 - 630
EKLVISASWAKDDDISRLLKSLPNWMNMAQPKQLRPKREEEEDFIRAAFGKESEVLIGNLGDKLIPPQDI    631 - 700
LRDVSDLKALANMHESLEWLASRTKSAFSNLSTSQMLSPAQDSHTNTDLPPVSEQIMQTLSELAKSFQDM    701 - 770
ADRCLLVLHLEVRVHCFHYLIPLAKEGNYAIVANVESMDYDPLVVKLNKDISAIEEAMSASLQQHKFQYI    771 - 840
FEGLGHLISCILINGAQYFRRISESGIKKMCRNIFVLQQNLTNITMSREADLDFARQYYEMLYNTADELL    841 - 910
NLVVDQGVKYTELEYIHALTLLHRSQTGVGELTTQNTRLQRLKEIICEQAAIKQATKDKKITTV          911 - 974
//

Text Mined References (53)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26283729 2015 Role of the Exocyst Complex Component Sec6/8 in Genomic Stability.
25725287 2015 Sec8 regulates cytokeratin8 phosphorylation and cell migration by controlling the ERK and p38 MAPK signalling pathways.
25594178 2015 A kinase-independent role for EGF receptor in autophagy initiation.
25244576 2014 Knockdown of Sec8 enhances the binding affinity of c-Jun N-terminal kinase (JNK)-interacting protein 4 for mitogen-activated protein kinase kinase 4 (MKK4) and suppresses the phosphorylation of MKK4, p38, and JNK, thereby inhibiting apoptosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23207790 2013 Exocyst complex component Sec8: a presumed component in the progression of human oral squamous-cell carcinoma by secretion of matrix metalloproteinases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...