Property Summary

NCBI Gene PubMed Count 42
PubMed Score 38.13
PubTator Score 23.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 2.500 4.7e-03
ependymoma 2.600 5.1e-03
oligodendroglioma 2.500 2.3e-03
atypical teratoid / rhabdoid tumor 1.200 4.0e-03
glioblastoma 1.200 9.0e-03
group 4 medulloblastoma 1.600 4.5e-04
medulloblastoma, large-cell 1.500 1.2e-04
tuberculosis 1.500 4.8e-07
ovarian cancer 1.200 9.5e-04

Protein-protein Interaction (7)

Gene RIF (13)

PMID Text
26350970 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC4
26283729 Sec8 regulates histone-modifying proteins ATF2 and RNF20.
25725287 Sec8 knockdown in HSC3 cells resulted in reduced expressions of PAK1 and PAK2 by upregulating Pirh2 and Siah1 expression, which inhibited the ERK or p38 MAPK signalling pathway and cytokeratin8 phosphorylation and cell migration.
25244576 knockdown of Sec8 enhances the binding of JIP4 to MAPK kinase 4, thereby decreasing the phosphorylation of MAPK kinase 4, JNK, and p38.
23207790 High Sec8 expression is associated with progression of oral squamous-cell carcinoma by secretion of matrix metalloproteinases.
23169490 Exome sequencing revealed a likely pathogenic mutation in three novel candidate MKS disease genes-C5orf42, EVC2 and SEC8 (also known as EXOC4), which encodes an exocyst protein with an established role in ciliogenesis
22534017 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC4
22190034 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC4
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18541705 The exocyst subunits Sec3 and Sec8 interact with the polarity protein IQGAP1 and that this interaction is triggered by active Cdc42 and RhoA, which are essential for matrix degradation.
18498660 EXOC4 is involved in insulin-stimulated glucose transport and may be a candidate for an association with type 2 diabetes.
18498660 Observational study of gene-disease association. (HuGE Navigator)
15880602 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELT      1 - 70
TAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIEHKHVLNLLDEIENIKQVPQK     71 - 140
LEQCMASKHYLSATDMLVSAVESLEGPLLQVEGLSDLRLELHSKKMNLHLVLIDELHRHLYIKSTSRVVQ    141 - 210
RNKEKGKISSLVKDASVPLIDVTNLPTPRKFLDTSHYSTAGSSSVREINLQDIKEDLELDPEENSTLFMG    211 - 280
ILIKGLAKLKKIPETVKAIIERLEQELKQIVKRSTTQVADSGYQRGENVTVENQPRLLLELLELLFDKFN    281 - 350
AVAAAHSVVLGYLQDTVVTPLTQQEDIKLYDMADVWVKIQDVLQMLLTEYLDMKNTRTASEPSAQLSYAS    351 - 420
TGREFAAFFAKKKPQRPKNSLFKFESSSHAISMSAYLREQRRELYSRSGELQGGPDDNLIEGGGTKFVCK    421 - 490
PGARNITVIFHPLLRFIQEIEHALGLGPAKQCPLREFLTVYIKNIFLNQVLAEINKEIEGVTKTSDPLKI    491 - 560
LANADTMKVLGVQRPLLQSTIIVEKTVQDLLNLMHDLSAYSDQFLNMVCVKLQEYKDTCTAAYRGIVQSE    561 - 630
EKLVISASWAKDDDISRLLKSLPNWMNMAQPKQLRPKREEEEDFIRAAFGKESEVLIGNLGDKLIPPQDI    631 - 700
LRDVSDLKALANMHESLEWLASRTKSAFSNLSTSQMLSPAQDSHTNTDLPPVSEQIMQTLSELAKSFQDM    701 - 770
ADRCLLVLHLEVRVHCFHYLIPLAKEGNYAIVANVESMDYDPLVVKLNKDISAIEEAMSASLQQHKFQYI    771 - 840
FEGLGHLISCILINGAQYFRRISESGIKKMCRNIFVLQQNLTNITMSREADLDFARQYYEMLYNTADELL    841 - 910
NLVVDQGVKYTELEYIHALTLLHRSQTGVGELTTQNTRLQRLKEIICEQAAIKQATKDKKITTV          911 - 974
//

Text Mined References (53)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26283729 2015 Role of the Exocyst Complex Component Sec6/8 in Genomic Stability.
25725287 2015 Sec8 regulates cytokeratin8 phosphorylation and cell migration by controlling the ERK and p38 MAPK signalling pathways.
25594178 2015 A kinase-independent role for EGF receptor in autophagy initiation.
25244576 2014 Knockdown of Sec8 enhances the binding affinity of c-Jun N-terminal kinase (JNK)-interacting protein 4 for mitogen-activated protein kinase kinase 4 (MKK4) and suppresses the phosphorylation of MKK4, p38, and JNK, thereby inhibiting apoptosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23207790 2013 Exocyst complex component Sec8: a presumed component in the progression of human oral squamous-cell carcinoma by secretion of matrix metalloproteinases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23169490 2013 Genomic analysis of Meckel-Gruber syndrome in Arabs reveals marked genetic heterogeneity and novel candidate genes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21241894 2011 RalB and the exocyst mediate the cellular starvation response by direct activation of autophagosome assembly.
20579884 2010 Salmonella-directed recruitment of new membrane to invasion foci via the host exocyst complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18987618 2009 Screening for replication of genome-wide SNP associations in sporadic ALS.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18541705 2008 The interaction of IQGAP1 with the exocyst complex is required for tumor cell invasion downstream of Cdc42 and RhoA.
18498660 2008 Polymorphisms near EXOC4 and LRGUK on chromosome 7q32 are associated with Type 2 Diabetes and fasting glucose; the NHLBI Family Heart Study.
18480549 2008 Involvement of Exoc3l, a protein structurally related to the exocyst subunit Sec6, in insulin secretion.
18329369 2008 Final stages of cytokinesis and midbody ring formation are controlled by BRUCE.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903302 2007 Framingham Heart Study 100K Project: genome-wide associations for blood pressure and arterial stiffness.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16381901 2006 The LIFEdb database in 2006.
15880602 2005 Association between single-nucleotide polymorphisms in the SEC8L1 gene, which encodes a subunit of the exocyst complex, and rheumatoid arthritis in a Japanese population.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15037366 2004 The exocyst complex in polarized exocytosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14525976 2003 Ral GTPases regulate exocyst assembly through dual subunit interactions.
12853948 2003 The DNA sequence of human chromosome 7.
12738960 2003 NMDA receptor trafficking through an interaction between PDZ proteins and the exocyst complex.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12687004 2003 The exocyst complex is required for targeting of Glut4 to the plasma membrane by insulin.
12675619 2003 Exocyst complex subunit sec8 binds to postsynaptic density protein-95 (PSD-95): a novel interaction regulated by cypin (cytosolic PSD-95 interactor).
12544826 2003 The septin protein Nedd5 associates with both the exocyst complex and microtubules and disruption of its GTPase activity promotes aberrant neurite sprouting in PC12 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11865051 2002 Ral-GTPase influences the regulation of the readily releasable pool of synaptic vesicles.
11406615 2001 The brain exocyst complex interacts with RalA in a GTP-dependent manner: identification of a novel mammalian Sec3 gene and a second Sec15 gene.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9655500 1998 Subunit composition, protein interactions, and structures of the mammalian brain sec6/8 complex and septin filaments.
9630218 1998 Sec6/8 complex is recruited to cell-cell contacts and specifies transport vesicle delivery to the basal-lateral membrane in epithelial cells.
9405631 1997 Subunit structure of the mammalian exocyst complex.