Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.55
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -2.200 0.000
osteosarcoma -2.457 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.700 0.001
medulloblastoma, large-cell -1.700 0.001
adrenocortical carcinoma 1.350 0.000
non-small cell lung cancer -1.029 0.000
lung cancer 1.100 0.022
Pick disease 1.100 0.001

AA Sequence

MAGYATTPSPMQTLQEEAVCAICLDYFKDPVSISCGHNFCRGCVTQLWSKEDEEDQNEEEDEWEEEEDEE      1 - 70
AVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEEEEEEEEDQDYYLGGLR     71 - 140
PDLRIDVYREEEILEAYDEDEDEELYPDIHPPPSLPLPGQFTCPQCRKSFTRRSFRPNLQLANMVQIIRQ    141 - 210
MCPTPYRGNRSNDQGMCFKHQEALKLFCEVDKEAICVVCRESRSHKQHSVLPLEEVVQEYQEIKLETTLV    211 - 280
GILQIEQESIHSKAYNQ                                                         281 - 297
//

Text Mined References (6)

PMID Year Title
24158625 2013 An evolutionary screen highlights canonical and noncanonical candidate antiviral genes within the primate TRIM gene family.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
20596523 2010 Development and validation of a method for profiling post-translational modification activities using protein microarrays.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.