Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.41
PubTator Score 9.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.100 1.1e-02
atypical teratoid / rhabdoid tumor 1.400 4.0e-04
ductal carcinoma in situ 1.100 2.2e-02
fibroadenoma 1.900 1.8e-02
interstitial cystitis -1.100 6.8e-03
intraductal papillary-mucinous carcinoma... 1.300 2.4e-02
invasive ductal carcinoma 1.100 3.1e-02
non-small cell lung cancer 1.227 3.5e-17
ovarian cancer 1.500 4.7e-05
posterior fossa group B ependymoma 1.400 5.9e-06
spina bifida -2.084 4.7e-02
ulcerative colitis -1.600 3.4e-06

Gene RIF (4)

AA Sequence

MEDPSGAREPRARPRERDPGRRPHPDQGRTHDRPRDRPGDPRRKRSSDGNRRRDGDRDPERDQERDGNRD      1 - 70
RNRDRERERERERDPDRGPRRDTHRDAGPRAGEHGVWEKPRQSRTRDGARGLTWDAAAPPGPAPWEAPEP     71 - 140
PQPQRKGDPGRRRPESEPPSERYLPSTPRPGREEVEYYQSEAEGLLECHKCKYLCTGRACCQMLEVLLNL    141 - 210
LILACSSVSYSSTGGYTGITSLGGIYYYQFGGAYSGFDGADGEKAQQLDVQFYQLKLPMVTVAMACSGAL    211 - 280
TALCCLFVAMGVLRVPWHCPLLLVTEGLLDMLIAGGYIPALYFYFHYLSAAYGSPVCKERQALYQSKGYS    281 - 350
GFGCSFHGADIGAGIFAALGIVVFALGAVLAIKGYRKVRKLKEKPAEMFEF                       351 - 401
//

Text Mined References (14)

PMID Year Title