Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.03
PubTator Score 9.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q96A59 A8K820 H3BQM5 Q96MJ4
Symbols MARVD3
MRVLDC3

Gene

Gene RIF (4)

PMID Text
24567356 MarvelD3 couples tight junctions to the MEKK1-JNK pathway to regulate cell behavior and survival.
21763689 MarvelD3 is transcriptionally downregulated in Snail-induced epithelial-mesenchymal transition during the progression for the pancreatic cancer.
20164257 marvelD3, occludin, and tricellulin define the tight junction-associated MARVEL protein family
20028514 MarvelD3 co-localises with occludin at tight junctions in intestinal and corneal epithelial cells.

AA Sequence

MEDPSGAREPRARPRERDPGRRPHPDQGRTHDRPRDRPGDPRRKRSSDGNRRRDGDRDPERDQERDGNRD      1 - 70
RNRDRERERERERDPDRGPRRDTHRDAGPRAGEHGVWEKPRQSRTRDGARGLTWDAAAPPGPAPWEAPEP     71 - 140
PQPQRKGDPGRRRPESEPPSERYLPSTPRPGREEVEYYQSEAEGLLECHKCKYLCTGRACCQMLEVLLNL    141 - 210
LILACSSVSYSSTGGYTGITSLGGIYYYQFGGAYSGFDGADGEKAQQLDVQFYQLKLPMVTVAMACSGAL    211 - 280
TALCCLFVAMGVLRVPWHCPLLLVTEGLLDMLIAGGYIPALYFYFHYLSAAYGSPVCKERQALYQSKGYS    281 - 350
GFGCSFHGADIGAGIFAALGIVVFALGAVLAIKGYRKVRKLKEKPAEMFEF                       351 - 401
//

Text Mined References (14)

PMID Year Title
24567356 2014 MarvelD3 couples tight junctions to the MEKK1-JNK pathway to regulate cell behavior and survival.
23203797 2013 In tight junctions, claudins regulate the interactions between occludin, tricellulin and marvelD3, which, inversely, modulate claudin oligomerization.
22895189 2012 Genome-wide association study indicates two novel resistance loci for severe malaria.
21763689 2011 Downregulation of tight junction-associated MARVEL protein marvelD3 during epithelial-mesenchymal transition in human pancreatic cancer cells.
20164257 2010 Tight junction-associated MARVEL proteins marveld3, tricellulin, and occludin have distinct but overlapping functions.
20028514 2009 Identification of MarvelD3 as a tight junction-associated transmembrane protein of the occludin family.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...