Property Summary

NCBI Gene PubMed Count 12
PubMed Score 16.06
PubTator Score 9.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 5.33512444098923E-16
lung adenocarcinoma 2714 4.92436740367618E-13
ovarian cancer 8492 4.85932909423203E-10
atypical teratoid / rhabdoid tumor 4369 6.28528961138046E-7
medulloblastoma 1524 2.06910964888621E-5
glioblastoma 5572 5.95662136015516E-5
pilocytic astrocytoma 3086 8.0388929351026E-5
head and neck cancer 270 1.03787529752839E-4
posterior fossa group B ependymoma 1530 3.10846026620489E-4
pituitary cancer 1972 3.17217072593017E-4
pediatric high grade glioma 2712 3.36869410387101E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00166362034554735
inflammatory breast cancer 404 0.00224491445641135
primitive neuroectodermal tumor 3031 0.00518053132008868
astrocytic glioma 2241 0.00533572515948589
facioscapulohumeral dystrophy 286 0.00808589802743422
subependymal giant cell astrocytoma 2287 0.0133492293844465
oligodendroglioma 2849 0.0163065806451996
adrenocortical carcinoma 1427 0.0360609488557984
Disease Target Count Z-score Confidence
Pituitary carcinoma 1 3.287 1.6

Expression

Synonym

Accession Q96A58 B2R9R0 B4DI02
Symbols

Gene

PDB

2ATV  

  Ortholog (11)

Gene RIF (7)

PMID Text
24992181 Estradiol estrogen receptor-beta and PGE2 integrate at RERG, leading to increased endometriotic cell proliferation.
21270509 Results describe the mRNA expression of CRABP1, RERG, and GRP in pituitary adenomas.
20697807 Loss of RERG expression is associated with breast cancer and distant metastasis.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQR      1 - 70
EGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLATEL     71 - 140
ACAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLTKISS               141 - 199
//

Text Mined References (14)

PMID Year Title
24992181 2014 ER?- and prostaglandin E2-regulated pathways integrate cell proliferation via Ras-like and estrogen-regulated growth inhibitor in endometriosis.
21270509 2011 Expression of CRABP1, GRP, and RERG mRNA in clinically non-functioning and functioning pituitary adenomas.
20697807 2011 RERG (Ras-like, oestrogen-regulated, growth-inhibitor) expression in breast cancer: a marker of ER-positive luminal-like subtype.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
More...