Property Summary

NCBI Gene PubMed Count 13
PubMed Score 18.22
PubTator Score 9.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.605 3.6e-02
adult high grade glioma -1.800 5.9e-03
astrocytic glioma -2.000 5.3e-03
Astrocytoma, Pilocytic -1.800 8.3e-05
atypical teratoid / rhabdoid tumor -2.400 6.3e-07
Breast cancer -1.700 4.2e-04
facioscapulohumeral dystrophy -1.900 8.1e-03
glioblastoma -1.800 1.9e-04
group 4 medulloblastoma -1.800 5.3e-03
head and neck cancer -2.300 1.0e-04
intraductal papillary-mucinous carcinoma... -2.100 1.7e-03
lung adenocarcinoma -1.100 2.4e-07
non-small cell lung cancer -1.575 5.3e-16
oligodendroglioma -2.100 1.6e-02
ovarian cancer -3.800 4.9e-10
pituitary cancer 2.300 3.2e-04
posterior fossa group B ependymoma 1.400 1.4e-03
primitive neuroectodermal tumor -2.000 5.2e-03
subependymal giant cell astrocytoma -1.146 1.3e-02

Gene RIF (8)

AA Sequence

MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQR      1 - 70
EGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLATEL     71 - 140
ACAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLTKISS               141 - 199
//

Text Mined References (15)

PMID Year Title