Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
Funding $131,266.75
PubMed Score 16.06
PubTator Score 9.61

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
24992181 Estradiol estrogen receptor-beta and PGE2 integrate at RERG, leading to increased endometriotic cell proliferation.
21270509 Results describe the mRNA expression of CRABP1, RERG, and GRP in pituitary adenomas.
20697807 Loss of RERG expression is associated with breast cancer and distant metastasis.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQR      1 - 70
EGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLATEL     71 - 140
ACAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLTKISS               141 - 199
//

Text Mined References (14)

PMID Year Title
24992181 2014 ER?- and prostaglandin E2-regulated pathways integrate cell proliferation via Ras-like and estrogen-regulated growth inhibitor in endometriosis.
21270509 2011 Expression of CRABP1, GRP, and RERG mRNA in clinically non-functioning and functioning pituitary adenomas.
20697807 2011 RERG (Ras-like, oestrogen-regulated, growth-inhibitor) expression in breast cancer: a marker of ER-positive luminal-like subtype.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
More...