Property Summary

NCBI Gene PubMed Count 15
PubMed Score 18.59
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Parkinson Disease 64 0.0 0.0
Disease Target Count Z-score Confidence
Parkinson's disease 392 4.449 2.2
Neurodegenerative disease 414 0.0 4.0

Expression

 GO Process (1)

Gene RIF (6)

AA Sequence

MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGY      1 - 70
ISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD                         71 - 120
//

Text Mined References (22)

PMID Year Title