Property Summary

NCBI Gene PubMed Count 39
Grant Count 51
R01 Count 41
Funding $7,537,998.76
PubMed Score 218.23
PubTator Score 90.52

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 GWAS Trait (1)

Gene RIF (32)

PMID Text
26813458 miR-205/TP53INP1 mediated autophagy pathway might be an important molecular mechanism regulating radiosensitivity of prostate cancer cells
26512655 silencing of TP53inp1 leads radiation induced autophagy impairment and induces accumulation of damaged mitochondria in primary human fibroblasts.
26367773 FOXP1, TP53INP1, TNFAIP3, and TUSC2 were identified as miR-19a targets.
26252115 MicroRNA205 promotes the tumorigenesis of nasopharyngeal carcinoma through targeting TP53INP1 protein.
25633840 TGFB1 induced miR-155 regulates TP53INP1 expression, epithelial-mesenchymal transition and acquisition of a stem cell phenotype.
25601564 miR-155 may play an important role in promoting the generation of stem cell-like cells and their self-renewal by targeting the gene TP53INP1.
25490449 Results demonstrate that miR-569 is overexpressed in a subset of ovarian and breast cancers and alters cell survival and proliferation through downregulation of TP53INP1 expression.
24922517 GWAS identifies TP53INP1 as new susceptibility gene for Alzheimer's disease.
24608790 TP53INP1 SUMOylation is essential for the regulation of p53 activity induced by oxidative stress.
24551280 Study reveals that miR-155 acts as an oncogene by targeting TP53INP1 in esophageal squamous cell carcinoma.
More...

AA Sequence

MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLP      1 - 70
ASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPG     71 - 140
LSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLR    141 - 210
RQNLTRDCHPRQVKHNGWVVHQPCPRQYNY                                            211 - 240
//

Text Mined References (40)

PMID Year Title
26813458 2016 MiR-205 suppresses autophagy and enhances radiosensitivity of prostate cancer cells by targeting TP53INP1.
26512655 2015 TP53inp1 Gene Is Implicated in Early Radiation Response in Human Fibroblast Cells.
26367773 2015 Uncovering Direct Targets of MiR-19a Involved in Lung Cancer Progression.
26252115 2015 MicroRNA?205 promotes the tumorigenesis of nasopharyngeal carcinoma through targeting tumor protein p53-inducible nuclear protein 1.
25633840 2015 TGF-?1 acts through miR-155 to down-regulate TP53INP1 in promoting epithelial-mesenchymal transition and cancer stem cell phenotypes.
25601564 2015 MiR-155 targets TP53INP1 to regulate liver cancer stem cell acquisition and self-renewal.
25490449 2014 Copy number gain of hsa-miR-569 at 3q26.2 leads to loss of TP53INP1 and aggressiveness of epithelial cancers.
24922517 2014 Gene-wide analysis detects two new susceptibility genes for Alzheimer's disease.
24608790 2014 Oxidative stress-induced p53 activity is enhanced by a redox-sensitive TP53INP1 SUMOylation.
24551280 2014 microRNA-155 acts as an oncogene by targeting the tumor protein 53-induced nuclear protein 1 in esophageal squamous cell carcinoma.
More...