Property Summary

NCBI Gene PubMed Count 42
PubMed Score 223.81
PubTator Score 90.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.721 1.2e-06
adult high grade glioma 1.800 3.5e-04
Amyotrophic lateral sclerosis 1.128 5.2e-06
astrocytoma 1.700 6.9e-31
Astrocytoma, Pilocytic 2.300 8.9e-09
atypical teratoid / rhabdoid tumor 2.300 2.9e-07
autosomal dominant Emery-Dreifuss muscul... 1.122 2.0e-03
chronic lymphosyte leukemia -1.200 4.8e-06
ductal carcinoma in situ 1.100 5.5e-03
ependymoma 2.200 4.0e-14
gastric carcinoma 1.500 3.7e-02
glioblastoma 1.700 2.3e-08
group 3 medulloblastoma 2.600 1.5e-04
invasive ductal carcinoma 1.589 1.2e-04
juvenile dermatomyositis 1.488 2.7e-12
medulloblastoma, large-cell 1.400 8.4e-05
oligodendroglioma 1.500 7.6e-14
osteosarcoma -1.023 1.7e-02
ovarian cancer -2.300 1.7e-08
primitive neuroectodermal tumor 2.400 2.6e-06
subependymal giant cell astrocytoma 2.255 7.2e-03
tuberculosis 1.400 1.8e-07

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (35)

AA Sequence

MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLP      1 - 70
ASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPG     71 - 140
LSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLR    141 - 210
RQNLTRDCHPRQVKHNGWVVHQPCPRQYNY                                            211 - 240
//

Text Mined References (43)

PMID Year Title