Property Summary

NCBI Gene PubMed Count 191
Grant Count 64
R01 Count 49
Funding $3,546,714.16
PubMed Score 184.58
PubTator Score 191.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.540 0.000
non primary Sjogren syndrome sicca 1.200 0.017
invasive ductal carcinoma 1.100 0.000

Synonym

Accession Q96A54 B3KMB0 Q53HS7 Q53YY6 Q9Y360
Symbols CGI45
PAQR1
ACDCR1
CGI-45
TESBP1A

Gene

PANTHER Protein Class (1)

PDB

3WXV  

Gene RIF (200)

PMID Text
26741812 ADPOR1 variants, rs3737884*G and rs7514221*C, may be shared risk factors associated with CAD, T2D, and T2D with CAD in a population of northeast China.
26631404 PCR results showed expression of adiponectin, AdipoR1, AdipoR2, follicle-stimulating hormone receptor (FSHR), and luteinizing hormone receptor (LHR) in granulosa cells (GCs). After controlling body mass index (BMI) values, qRT-PCR demonstrated a decreased expression of adiponectin system in GCs of polycystic ovary syndromepatients compared to those in controls
26459399 Expression of AdipoR1 gene receptor was increased in endometriotic stromal cells.
26160610 miR-323 may increase VEGF-A-mediated cancer vascularization in PC cells through AdipoR1 suppression.
26146630 In conclusion, neutrophil AdipoRs (AdipoR1, AdipoR2) upregulation was associated with early stages of vascular injury, hypertension severity, and low serum levels of adiponectin
26111083 We did not find any significant associations with ADIPOR1 gene variants and fasting plasma triglycerides in HIV-infected patients.
26047008 The ADIPOR1 rs1342387(G/A) polymorphism, but not rs12733285(C/T) or rs7539542(C/G), may be associated with cancer risk, especially risk of colorectal cancer in Asians.
25892445 Results demonstrate that the non-conserved N-terminal trunks dictate the cell-surface expression and temporal signaling profiles of AdipoR1 and AdipoR2.
25855295 crystal structures of the human adiponectin receptors AdipoR1 and AdipoR2 at 2.9 A and 2.4 A resolution, respectively
25640382 This study indicated that ApN may play a role in the progression of colorectal adenomatous polyps to carcinoma through actions on adipo-R1 and adipo-R2 receptors.
More...

AA Sequence

MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLP      1 - 70
LQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWT     71 - 140
HLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYS    141 - 210
GIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVV    211 - 280
PTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFV    281 - 350
HFYGVSNLQEFRYGLEGGCTDDTLL                                                 351 - 375
//

Text Mined References (191)

PMID Year Title
26741812 2016 Analysis of the Relationship Between ADIPOR1 Variants and the Susceptibility of Chronic Metabolic Diseases in a Northeast Han Chinese Population.
26631404 2016 Downregulation of adiponectin system in granulosa cells and low levels of HMW adiponectin in PCOS.
26459399 2016 in vitro Anti-Proliferative Effect of Adiponectin on Human Endometriotic Stromal Cells through AdipoR1 and AdipoR2 Gene Receptor Expression.
26160610 2015 MiR-323 Inhibits Prostate Cancer Vascularization Through Adiponectin Receptor.
26146630 2015 Expression of Adiponectin Receptors on Peripheral Blood Leukocytes of Hypertensive Children Is Associated with the Severity of Hypertension.
26111083 2015 Polymorphisms in adiponectin receptor genes are associated with lipodystrophy-related phenotypes in HIV-infected patients receiving antiretroviral therapy.
26047008 2015 Three ADIPOR1 Polymorphisms and Cancer Risk: A Meta-Analysis of Case-Control Studies.
25892445 2015 Characterisation of the adiponectin receptors: Differential cell-surface expression and temporal signalling profiles of AdipoR1 and AdipoR2 are regulated by the non-conserved N-terminal trunks.
25855295 2015 Crystal structures of the human adiponectin receptors.
25640382 2015 Adipo-R1 and adipo-R2 expression in colorectal adenomas and carcinomas.
More...