Property Summary

NCBI Gene PubMed Count 199
PubMed Score 202.91
PubTator Score 191.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
invasive ductal carcinoma 1.100 4.8e-04
Multiple myeloma 1.540 1.5e-04
non primary Sjogren syndrome sicca 1.200 1.7e-02

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (208)

AA Sequence

MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLP      1 - 70
LQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWT     71 - 140
HLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYS    141 - 210
GIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVV    211 - 280
PTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFV    281 - 350
HFYGVSNLQEFRYGLEGGCTDDTLL                                                 351 - 375
//

Text Mined References (199)

PMID Year Title