Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.12
PubTator Score 2.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 4.2e-05
ovarian cancer 8520 1.9e-04
tuberculosis 2010 2.4e-04
breast carcinoma 1638 3.1e-03
diabetes mellitus 1728 1.0e-02
Disease Target Count Z-score Confidence
Nance-Horan syndrome 25 5.001 2.5

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.100 4.2e-05
breast carcinoma 1.500 3.1e-03
diabetes mellitus -1.100 1.0e-02
ovarian cancer 1.200 1.9e-04
tuberculosis -1.300 2.4e-04

Synonym

Accession Q96A49 Q68CP1 Q96C60 Q96JQ6 Q96T20
Symbols PRO3113

Gene

PDB

1X3A  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MFRGLSSWLGLQQPVAGGGQPNGDAPPEQPSETVAESAEEELQQAGDQELLHQAKDFGNYLFNFASAATK      1 - 70
KITESVAETAQTIKKSVEEGKIDGIIDKTIIGDFQKEQKKFVEEQHTKKSEAAVPPWVDTNDEETIQQQI     71 - 140
LALSADKRNFLRDPPAGVQFNFDFDQMYPVALVMLQEDELLSKMRFALVPKLVKEEVFWRNYFYRVSLIK    141 - 210
QSAQLTALAAQQQAAGKEEKSNGREQDLPLAEAVRPKTPPVVIKSQLKTQEDEEEISTSPGVSEFVSDAF    211 - 280
DACNLNQEDLRKEMEQLVLDKKQEETAVLEEDSADWEKELQQELQEYEVVTESEKRDENWDKEIEKMLQE    281 - 350
EN                                                                        351 - 352
//

Text Mined References (23)

PMID Year Title