Property Summary

NCBI Gene PubMed Count 9
PubMed Score 27.66
PubTator Score 13.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 3.86192018076049E-6
glioblastoma 5572 7.72689165728048E-5
atypical teratoid / rhabdoid tumor 4369 4.48193168702384E-4
adult high grade glioma 2148 0.00241604708959545
Disease Target Count Z-score Confidence
Cortical blindness 15 4.275 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 3.200 0.000
adult high grade glioma 1.200 0.002

Synonym

Accession Q96A47 B3KM37 Islet-2
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Xenopus OMA Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
21190559 Experiments in Isl2/EphA3 knock-in mice test the interactions between effects of molecular labels and correlated activity during the development of neural connectivity.
17091338 The broad expression of Isl-2 gene in tissues during embryogenesis and adult development suggests that it may be involved in both differentiation and maintenance of these tissues and might play an important role.

AA Sequence

MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFV      1 - 70
RDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCR     71 - 140
ADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCY    141 - 210
AANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSP    211 - 280
IRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPN    281 - 350
SMVPSPVET                                                                 351 - 359
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21190559 2010 Sperry versus Hebb: topographic mapping in Isl2/EphA3 mutant mice.
20096094 2010 Brn3a regulates neuronal subtype specification in the trigeminal ganglion by promoting Runx expression during sensory differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17091338 2007 Cloning and expression of a novel human gene, Isl-2, encoded a LIM-homeodomain protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
More...