Property Summary

NCBI Gene PubMed Count 9
PubMed Score 28.19
PubTator Score 13.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.200 2.4e-03
atypical teratoid / rhabdoid tumor 1.200 4.5e-04
glioblastoma 1.300 7.7e-05
medulloblastoma, large-cell 3.200 3.9e-06

Gene RIF (2)

AA Sequence

MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFV      1 - 70
RDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCR     71 - 140
ADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCY    141 - 210
AANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSP    211 - 280
IRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPN    281 - 350
SMVPSPVET                                                                 351 - 359
//

Text Mined References (13)

PMID Year Title