Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.78
PubTator Score 9.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.400 2.7e-05
group 4 medulloblastoma -1.100 5.2e-04
medulloblastoma, large-cell -1.300 8.9e-06
osteosarcoma -1.693 2.5e-06

Gene RIF (4)

AA Sequence

MELEGRGAGGVAGGPAAGPGRSPGESALLDGWLQRGVGRGAGGGEAGACRPPVRQDPDSGPDYEALPAGA      1 - 70
TVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALWRIIRTEGLWRPMRGLNVTATG     71 - 140
AGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVATLLHDAAMNPAEVVKQRMQMYNSPYHRVTD    141 - 210
CVRAVWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATT    211 - 280
PLDVCKTLLNTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFK    281 - 350
YLITKRQEEWRAGK                                                            351 - 364
//

Text Mined References (15)

PMID Year Title