Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.78
PubTator Score 9.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 2.54522628994553E-6
medulloblastoma, large-cell 6234 8.88604412565215E-6
adult high grade glioma 2148 2.66690328342353E-5
group 4 medulloblastoma 1875 5.20500332496687E-4

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.693 0.000
medulloblastoma, large-cell -1.300 0.000
adult high grade glioma -1.400 0.000
group 4 medulloblastoma -1.100 0.001

Synonym

Accession Q96A46 Q4VBZ0 Q5T777 Q86VX5 Q969G8 Q9H2J3
Symbols MFRN2
MRS4L
MRS3/4
NPD016

Gene

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG
S.cerevisiae OMA Inparanoid

Gene RIF (4)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
23135267 Mitoferrin-2-dependent mitochondrial iron uptake sensitizes human head and neck squamous carcinoma cells to photodynamic therapy
20877624 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MELEGRGAGGVAGGPAAGPGRSPGESALLDGWLQRGVGRGAGGGEAGACRPPVRQDPDSGPDYEALPAGA      1 - 70
TVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALWRIIRTEGLWRPMRGLNVTATG     71 - 140
AGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVATLLHDAAMNPAEVVKQRMQMYNSPYHRVTD    141 - 210
CVRAVWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATT    211 - 280
PLDVCKTLLNTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFK    281 - 350
YLITKRQEEWRAGK                                                            351 - 364
//

Text Mined References (15)

PMID Year Title
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
23279374 2013 Genetic determinants of plasma ??-glycoprotein I levels: a genome-wide association study in extended pedigrees from Spain.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23135267 2013 Mitoferrin-2-dependent mitochondrial iron uptake sensitizes human head and neck squamous carcinoma cells to photodynamic therapy.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...