Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.92
PubTator Score 0.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.8e-04
adult high grade glioma 3801 6.9e-03

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma 1.100 6.9e-03
osteosarcoma -1.885 1.8e-04

Gene RIF (2)

AA Sequence

MAMFRSLVASAQQRQPPAGPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPLCP      1 - 70
LCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPI     71 - 140
PSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMPWGDPSYKSANFLQHLLHRHKF    141 - 210
SYDTFVDYSIDEEAAFQAALALSLSEN                                               211 - 237
//

Text Mined References (8)

PMID Year Title