Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.33
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.338 0.010
Multiple myeloma 2.298 0.000
osteosarcoma 1.213 0.000
astrocytoma 1.500 0.030
Amyotrophic Lateral Sclerosis 1.192 0.000
acute quadriplegic myopathy 2.403 0.000
pancreatic ductal adenocarcinoma liver m... -1.276 0.043
breast carcinoma 1.300 0.011
ovarian cancer 1.800 0.001

Synonym

Accession Q96A33 B2RAS8 D3DU20 Q96D00 Q96JZ7 Q9H3E4 Q9NRG3
Symbols GK001
MSTP041

Gene

Gene RIF (2)

PMID Text
25009997 these findings suggested that calumin serves to maintain the yolk sac integrity through participation in the ERAD activity, contributing to embryonic development.
22190034 HIV-1 Vpr is identified to have a physical interaction with coiled-coil domain containing 47 (CCDC47) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MKAFHTFCVVLLVFGSVSEAKFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVE      1 - 70
LEGQDENQEGDFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSKNKDPITIVDVPAHLQNSWESYYLEI     71 - 140
LMVTGLLAYIMNYIIGKNKNSRLAQAWFNTHRELLESNFTLVGDDGTNKEATSTGKLNQENEHIYNLWCS    141 - 210
GRVCCEGMLIQLRFLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYVFAVGTRKALVRLQKEMQDLS    211 - 280
EFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPL    281 - 350
KLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKL    351 - 420
THVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKVKAM           421 - 483
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25009997 2014 Contribution of calumin to embryogenesis through participation in the endoplasmic reticulum-associated degradation activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17204322 2007 Calumin, a novel Ca2+-binding transmembrane protein on the endoplasmic reticulum.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...