Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.33
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 2.403 1.3e-08
Amyotrophic lateral sclerosis 1.192 6.5e-06
astrocytoma 1.500 3.0e-02
breast carcinoma 1.300 1.1e-02
Multiple myeloma 2.298 3.9e-05
osteosarcoma 1.213 2.0e-04
ovarian cancer 1.800 1.4e-03
pancreatic ductal adenocarcinoma liver m... -1.276 4.3e-02
Waldenstrons macroglobulinemia 1.338 9.6e-03

Gene RIF (2)

AA Sequence

MKAFHTFCVVLLVFGSVSEAKFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVE      1 - 70
LEGQDENQEGDFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSKNKDPITIVDVPAHLQNSWESYYLEI     71 - 140
LMVTGLLAYIMNYIIGKNKNSRLAQAWFNTHRELLESNFTLVGDDGTNKEATSTGKLNQENEHIYNLWCS    141 - 210
GRVCCEGMLIQLRFLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYVFAVGTRKALVRLQKEMQDLS    211 - 280
EFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPL    281 - 350
KLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKL    351 - 420
THVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKVKAM           421 - 483
//

Text Mined References (16)

PMID Year Title