Property Summary

NCBI Gene PubMed Count 8
PubMed Score 20.16
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 9.8e-03
diabetes mellitus 1728 1.9e-02

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.300 1.9e-02
medulloblastoma, large-cell 1.800 9.8e-03

Gene RIF (1)

AA Sequence

MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAM      1 - 70
MKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMW     71 - 140
AAFPPDVGGNVDYKNICYVITHGDAKDQE                                             141 - 169
//

Text Mined References (9)

PMID Year Title