Property Summary

NCBI Gene PubMed Count 8
PubMed Score 19.51
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.800 0.010
diabetes mellitus -1.300 0.019

Synonym

Accession Q96A32 B2RA83 Q14843 Q6IB41
Symbols MLC2B
MRLC2
MYL11
HUMMLC2B

Gene

Gene RIF (1)

PMID Text
14756420 A cDNA clone encoding human fast skeletal myosin regulatory light chain (HSRLC) has been isolated and characterized from a fetal muscle cDNA library.

AA Sequence

MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAM      1 - 70
MKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMW     71 - 140
AAFPPDVGGNVDYKNICYVITHGDAKDQE                                             141 - 169
//

Text Mined References (9)

PMID Year Title
26663899 2015 Characterization of myosin II regulatory light chain isoforms in HeLa cells.
17897319 2007 Integral and associated lysosomal membrane proteins.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14756420 2003 Human fast skeletal myosin light chain 2 cDNA: isolation, tissue specific expression of the single copy gene, comparative sequence analysis of isoforms and evolutionary relationships.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
6179945 1982 Cloning and characterization of cDNA sequences corresponding to myosin light chains 1, 2, and 3, troponin-C, troponin-T, alpha-tropomyosin, and alpha-actin.
6091059 1984 The nucleotide sequence of a rat myosin light chain 2 gene.