Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.75
PubTator Score 10.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.300 1.3e-06

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MNRAPLKRSRILHMALTGASDPSAEAEANGEKPFLLRALQIALVVSLYWVTSISMVFLNKYLLDSPSLRL      1 - 70
DTPIFVTFYQCLVTTLLCKGLSALAACCPGAVDFPSLRLDLRVARSVLPLSVVFIGMITFNNLCLKYVGV     71 - 140
AFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGIIIGGFWLGVDQEGAEGTLSWLGTVFGVLASLCVS    141 - 210
LNAIYTTKVLPAVDGSIWRLTFYNNVNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAI    211 - 280
GYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWVRGWEMKKTPE    281 - 350
EPSPKDSEKSAMGV                                                            351 - 364
//

Text Mined References (19)

PMID Year Title