Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.75
PubTator Score 10.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.300 0.000

Synonym

Accession Q96A29 B2RDB2 Q9BV76 Q9NUJ8
Symbols CDG2C
FUCT1

Gene

PANTHER Protein Class (1)

Gene RIF (7)

PMID Text
25239688 two Turkish siblings with a novel mutation in GDP-fucose transporter and features of congenital disorder of glycosylation IIc
23730929 Fx enzyme and GDP-L-Fuc Tr overexpression in the tumur tissue of colorectal cancer (CRC) patients suggests that GDP-L-Fuc transport to the Golgi apparatus may be an important factor associated with increased alpha(1,6)fucosylation in CRC.
22492235 the conserved glycine residues at positions 180 and 277 of SLC35C1 have significant impacts on lectin binding
22134107 In the rare LAD-II disease, the fucosylation of selectin ligands is disturbed, caused by mutations in SLC35C1, the gene that encodes a GDP-fucose transporter of the Golgi system. (Review)
17884843 the upregulation of GDP-Fuc Tr plays a pivotal role in increased fucosylation in hepatocellular carcinoma
16455955 Leukocyte adhesion deficiency II patients display dual defect in functoin ang Golgi expression of FUCT1.
12406889 In the GDP-fucose transporter a new single nucleotide deletion produced an open-reading frame shift & polypeptide truncation. Overexpression of the mutant protein in fibroblasts did not rescue fucosylation. The deletion ablated transporter activity.

AA Sequence

MNRAPLKRSRILHMALTGASDPSAEAEANGEKPFLLRALQIALVVSLYWVTSISMVFLNKYLLDSPSLRL      1 - 70
DTPIFVTFYQCLVTTLLCKGLSALAACCPGAVDFPSLRLDLRVARSVLPLSVVFIGMITFNNLCLKYVGV     71 - 140
AFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGIIIGGFWLGVDQEGAEGTLSWLGTVFGVLASLCVS    141 - 210
LNAIYTTKVLPAVDGSIWRLTFYNNVNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAI    211 - 280
GYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWVRGWEMKKTPE    281 - 350
EPSPKDSEKSAMGV                                                            351 - 364
//

Text Mined References (19)

PMID Year Title
25239688 2014 A novel mutation in leukocyte adhesion deficiency type II/CDGIIc.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23730929 2013 FX enzyme and GDP-L-Fuc transporter expression in colorectal cancer.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22492235 2012 Identification of functional elements of the GDP-fucose transporter SLC35C1 using a novel Chinese hamster ovary mutant.
22134107 2012 Hematologically important mutations: leukocyte adhesion deficiency (first update).
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
17884843 2007 A high expression of GDP-fucose transporter in hepatocellular carcinoma is a key factor for increases in fucosylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
More...