Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.81
PubTator Score 3.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 4.6e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cysticercosis 14 4.255 2.1
Lymphoproliferative syndrome 58 4.084 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.019 4.6e-05

AA Sequence

MCAFPWLLLLLLLQEGSQRRLWRWCGSEEVVAVLQESISLPLEIPPDEEVENIIWSSHKSLATVVPGKEG      1 - 70
HPATIMVTNPHYQGQVSFLDPSYSLHISNLSWEDSGLYQAQVNLRTSQISTMQQYNICVYRWLSEPQITV     71 - 140
NFESSGEGACSMSLVCSVEKAGMDMTYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVS    141 - 210
SCPIPDGPFYADPNYASEKPSTAFCLLAKGLLIFLLLVILAMGLWVIRVQKRHKMPRMKKLMRNRMKLRK    211 - 280
EAKPGSSPA                                                                 281 - 289
//

Text Mined References (8)

PMID Year Title