Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.81
PubTator Score 3.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cysticercosis 12 4.701 2.4
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.296 0.000

AA Sequence

MCAFPWLLLLLLLQEGSQRRLWRWCGSEEVVAVLQESISLPLEIPPDEEVENIIWSSHKSLATVVPGKEG      1 - 70
HPATIMVTNPHYQGQVSFLDPSYSLHISNLSWEDSGLYQAQVNLRTSQISTMQQYNICVYRWLSEPQITV     71 - 140
NFESSGEGACSMSLVCSVEKAGMDMTYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVS    141 - 210
SCPIPDGPFYADPNYASEKPSTAFCLLAKGLLIFLLLVILAMGLWVIRVQKRHKMPRMKKLMRNRMKLRK    211 - 280
EAKPGSSPA                                                                 281 - 289
//

Text Mined References (8)

PMID Year Title
18501771 2008 The SLAM and SAP gene families control innate and adaptive immune responses.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11862385 2002 Identification and characterization of SF2000 and SF2001, two new members of the immune receptor SLAM/CD2 family.
11685473 2001 CD2F-10: a new member of the CD2 subset of the immunoglobulin superfamily.
11300479 2001 Genetic approach to insight into the immunobiology of human dendritic cells and identification of CD84-H1, a novel CD84 homologue.