Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.26
PubTator Score 0.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
breast carcinoma 1.100 3.7e-03
intraductal papillary-mucinous adenoma (... 1.100 5.7e-03
lung carcinoma -1.100 1.0e-21
ovarian cancer -1.300 5.1e-09
Rheumatoid arthritis 1.600 3.7e-03
spina bifida 1.137 4.8e-02
subependymal giant cell astrocytoma 1.376 1.0e-02
tuberculosis and treatment for 6 months -1.500 1.4e-04

Gene RIF (1)

AA Sequence

MGKTFSQLGSWREDENKSILSSKPAIGSKAVNYSSTGSSKSFCSCVPCEGTADASFVTCPTCQGSGKIPQ      1 - 70
ELEKQLVALIPYGDQRLKPKHTKLFVFLAVLICLVTSSFIVFFLFPRSVIVQPAGLNSSTVAFDEADIYL     71 - 140
NITNILNISNGNYYPIMVTQLTLEVLHLSLVVGQVSNNLLLHIGPLASEQMFYAVATKIRDENTYKICTW    141 - 210
LEIKVHHVLLHIQGTLTCSYLSHSEQLVFQSYEYVDCRGNASVPHQLTPHPP                      211 - 262
//

Text Mined References (9)

PMID Year Title