Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.33
PubTator Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.0116007876614E-21
ovarian cancer 8492 5.08621807626617E-9
tuberculosis and treatment for 6 months 686 1.40608683850035E-4
breast carcinoma 1614 0.00365128803654025
Rheumatoid Arthritis 1171 0.00374751255483938
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00565591704289074
subependymal giant cell astrocytoma 2287 0.0102738301225346
spina bifida 1064 0.0476565698273514

Expression

  Differential Expression (8)

Synonym

Accession Q96A25 A8K2X2 B7Z698
Symbols

Gene

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1)

PMID Text
24975047 Low TMEM106A expression is associated with gastric cancer.

AA Sequence

MGKTFSQLGSWREDENKSILSSKPAIGSKAVNYSSTGSSKSFCSCVPCEGTADASFVTCPTCQGSGKIPQ      1 - 70
ELEKQLVALIPYGDQRLKPKHTKLFVFLAVLICLVTSSFIVFFLFPRSVIVQPAGLNSSTVAFDEADIYL     71 - 140
NITNILNISNGNYYPIMVTQLTLEVLHLSLVVGQVSNNLLLHIGPLASEQMFYAVATKIRDENTYKICTW    141 - 210
LEIKVHHVLLHIQGTLTCSYLSHSEQLVFQSYEYVDCRGNASVPHQLTPHPP                      211 - 262
//

Text Mined References (9)

PMID Year Title
26215746 2015 Transmembrane protein 106a activates mouse peritoneal macrophages via the MAPK and NF-?B signaling pathways.
24975047 2014 Transmembrane protein 106A is silenced by promoter region hypermethylation and suppresses gastric cancer growth by inducing apoptosis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21989022 2011 A de novo complete BRCA1 gene deletion identified in a Spanish woman with early bilateral breast cancer.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.