Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.28
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -3.100 0.001
posterior fossa group A ependymoma -3.700 0.000
oligodendroglioma -2.500 0.007
glioblastoma -3.200 0.001
atypical teratoid / rhabdoid tumor -2.100 0.010
medulloblastoma, large-cell -2.500 0.047
primitive neuroectodermal tumor -3.200 0.004
pediatric high grade glioma -2.200 0.004
sonic hedgehog group medulloblastoma -3.500 0.000
pilocytic astrocytoma -2.000 0.006
lung carcinoma 3.000 0.000
Pick disease -1.400 0.042
psoriasis -1.600 0.000

Gene RIF (3)

PMID Text
25328121 Single nucleotide polymorphisms in CPEN4 gene is associated with Coronary Artery Disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12670487 Cloning, molecular characterization, and expression analysis. May have an important role to play in prostate regulation and development.

AA Sequence

MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTC      1 - 70
INPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGK     71 - 140
SSITVIAEELSGNDDYVELAFNARKLDDKDFFSKSDPFLEIFRMNDDATQQLVHRTEVVMNNLSPAWKSF    141 - 210
KVSVNSLCSGDPDRRLKCIVWDWDSNGKHDFIGEFTSTFKEMRGAMEGKQVQWECINPKYKAKKKNYKNS    211 - 280
GTVILNLCKIHKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQ    281 - 350
DYDSDKMFPAFGFGARIPPEYTVSHDFAINFNEDNPECAGIQGVVEAYQSCLPKLQLYGPTNIAPIIQKV    351 - 420
AKSASEETNTKEASQYFILLILTDGVITDMADTREAIVHASHLPMSVIIVGVGNADFSDMQMLDGDDGIL    421 - 490
RSPKGEPVLRDIVQFVPFRNFKHASPAALAKSVLAEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP       491 - 557
//

Text Mined References (13)

PMID Year Title
25328121 2015 Associations between Genetic Variants and Angiographic Characteristics in Patients with Coronary Artery Disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23202439 2013 Genome-wide scan for copy number variation association with age at onset of Alzheimer's disease.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12949241 2003 Tissue expression of copines and isolation of copines I and III from the cytosol of human neutrophils.
12670487 2003 Cloning, molecular characterization, and expression analysis of Copine 8.
More...