Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.28
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Motion sickness 32
Disease Target Count P-value
lung carcinoma 2844 9.39751791903253E-38
psoriasis 6685 7.02672491265986E-23
posterior fossa group A ependymoma 1511 1.85477551434904E-10
sonic hedgehog group medulloblastoma 1482 3.55656467757029E-4
glioblastoma 5572 6.02612102848882E-4
astrocytic glioma 2241 0.00119252358980339
pediatric high grade glioma 2712 0.00375566789600261
primitive neuroectodermal tumor 3031 0.00408623905210396
pilocytic astrocytoma 3086 0.00603924292704083
oligodendroglioma 2849 0.007025839343006
atypical teratoid / rhabdoid tumor 4369 0.00982779507303715
Pick disease 1893 0.0424188497713925
medulloblastoma, large-cell 6234 0.0471481128399049

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -3.100 0.001
posterior fossa group A ependymoma -3.700 0.000
oligodendroglioma -2.500 0.007
glioblastoma -3.200 0.001
atypical teratoid / rhabdoid tumor -2.100 0.010
medulloblastoma, large-cell -2.500 0.047
primitive neuroectodermal tumor -3.200 0.004
pediatric high grade glioma -2.200 0.004
sonic hedgehog group medulloblastoma -3.500 0.000
pilocytic astrocytoma -2.000 0.006
lung carcinoma 3.000 0.000
Pick disease -1.400 0.042
psoriasis -1.600 0.000

Synonym

Accession Q96A23 D3DNC5 Q8TEX1
Symbols CPN4
COPN4

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid

Gene RIF (3)

PMID Text
25328121 Single nucleotide polymorphisms in CPEN4 gene is associated with Coronary Artery Disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12670487 Cloning, molecular characterization, and expression analysis. May have an important role to play in prostate regulation and development.

AA Sequence

MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTC      1 - 70
INPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGK     71 - 140
SSITVIAEELSGNDDYVELAFNARKLDDKDFFSKSDPFLEIFRMNDDATQQLVHRTEVVMNNLSPAWKSF    141 - 210
KVSVNSLCSGDPDRRLKCIVWDWDSNGKHDFIGEFTSTFKEMRGAMEGKQVQWECINPKYKAKKKNYKNS    211 - 280
GTVILNLCKIHKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQ    281 - 350
DYDSDKMFPAFGFGARIPPEYTVSHDFAINFNEDNPECAGIQGVVEAYQSCLPKLQLYGPTNIAPIIQKV    351 - 420
AKSASEETNTKEASQYFILLILTDGVITDMADTREAIVHASHLPMSVIIVGVGNADFSDMQMLDGDDGIL    421 - 490
RSPKGEPVLRDIVQFVPFRNFKHASPAALAKSVLAEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP       491 - 557
//

Text Mined References (13)

PMID Year Title
25328121 2015 Associations between Genetic Variants and Angiographic Characteristics in Patients with Coronary Artery Disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23202439 2013 Genome-wide scan for copy number variation association with age at onset of Alzheimer's disease.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12949241 2003 Tissue expression of copines and isolation of copines I and III from the cytosol of human neutrophils.
12670487 2003 Cloning, molecular characterization, and expression analysis of Copine 8.
More...