Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.09
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MGNRVCCGGSWSCPSTFQKKKKTGSQTRRTLKPQPQQLQQNLPKGHETTGHTYERVLQQQGSQERSPGLM      1 - 70
SEDSNLHYADIQVCSRPHAREVKHVHLENATEYATLRFPQATPRYDSKNGTLV                      71 - 123
//

Text Mined References (8)

PMID Year Title