Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.81
PubTator Score 2.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
pituitary cancer 1,972
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
pituitary cancer 2.700 0.000
psoriasis -1.500 0.006

Synonym

Accession Q96A11 Q14D05 Gal3ST-3
Symbols GAL3ST2
GAL3ST-3

Gene

Gene RIF (1)

PMID Text
14701868 Gal3ST-2 and LS180 sulfotransferase is a substrate for the globo H backbone; Gal3ST-3 is a substrate for N-glycan multiterminal Galbeta1

AA Sequence

MPPILQRLQQATKMMSRRKILLLVLGCSTVSLLIHQGAQLSWYPKLFPLSCPPLRNSPPRPKHMTVAFLK      1 - 70
THKTAGTTVQNILFRFAERHNLTVALPHPSCEHQFCYPRNFSAHFVHPATRPPHVLASHLRFDRAELERL     71 - 140
MPPSTVYVTILREPAAMFESLFSYYNQYCPAFRRVPNASLEAFLRAPEAYYRAGEHFAMFAHNTLAYDLG    141 - 210
GDNERSPRDDAAYLAGLIRQVEEVFSLVMIAEYFDESLVLLRRLLAWDLDDVLYAKLNARAASSRLAAIP    211 - 280
AALARAARTWNALDAGLYDHFNATFWRHVARAGRACVEREARELREARQRLLRRCFGDEPLLRPAAQIRT    281 - 350
KQLQPWQPSRKVDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEPVLDNPPPRP    351 - 420
IRVLPRGPQGP                                                               421 - 431
//

Text Mined References (10)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14701868 2004 Identification of physiologically relevant substrates for cloned Gal: 3-O-sulfotransferases (Gal3STs): distinct high affinity of Gal3ST-2 and LS180 sulfotransferase for the globo H backbone, Gal3ST-3 for N-glycan multiterminal Galbeta1, 4GlcNAcbeta units and 6-sulfoGalbeta1, 4GlcNAcbeta, and Gal3ST-4 for the mucin core-2 trisaccharide.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11356829 2001 A novel human Gal-3-O-sulfotransferase: molecular cloning, characterization, and its implications in biosynthesis of (SO(4)-3)Galbeta1-4(Fucalpha1-3)GlcNAc.
11333265 2001 Molecular cloning and characterization of a novel human galactose 3-O-sulfotransferase that transfers sulfate to gal beta 1-->3galNAc residue in O-glycans.
11323440 2001 Molecular cloning and expression of a novel human beta-Gal-3-O-sulfotransferase that acts preferentially on N-acetyllactosamine in N- and O-glycans.
10815989 1999 Characterization of distinct Gal:3-O-sulfotransferase activities in human tumor epithelial cell lines and of calf lymph node GlcNAc : 6-O-sulfotransferase activity.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.