Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.42
PubTator Score 0.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.857 0.000
posterior fossa group A ependymoma 1.600 0.000
cystic fibrosis -1.916 0.000
atypical teratoid / rhabdoid tumor 1.800 0.004
non-small cell lung cancer -1.800 0.000
primary Sjogren syndrome -1.300 0.005
lung adenocarcinoma -1.700 0.000
Breast cancer -1.300 0.000
spina bifida -2.278 0.036
pituitary cancer -1.100 0.018

Synonym

Accession Q96A09
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MMPSESGAERRDRAAAQVGTAAATAVATAAPAGGGPDPEALSAFPGRHLSGLSWPQVKRLDALLSEPIPI      1 - 70
HGRGNFPTLSVQPRQIVQVVRSTLEEQGLHVHSVRLHGSAASHVLHPESGLGYKDLDLVFRVDLRSEASF     71 - 140
QLTKAVVLACLLDFLPAGVSRAKITPLTLKEAYVQKLVKVCTDSDRWSLISLSNKSGKNVELKFVDSVRR    141 - 210
QFEFSIDSFQIILDSLLLFGQCSSTPMSEAFHPTVTGESLYGDFTEALEHLRHRVIATRSPEEIRGGGLL    211 - 280
KYCHLLVRGFRPRPSTDVRALQRYMCSRFFIDFPDLVEQRRTLERYLEAHFGGADAARRYACLVTLHRVV    281 - 350
NESTVCLMNHERRQTLDLIAALALQALAEQGPAATAALAWRPPGTDGVVPATVNYYVTPVQPLLAHAYPT    351 - 420
WLPCN                                                                     421 - 425
//

Text Mined References (10)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
19060904 2009 An empirical framework for binary interactome mapping.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.