Property Summary

NCBI Gene PubMed Count 21
PubMed Score 41.36
PubTator Score 9.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q96A08 B2R544 Q6NZ98 Q6NZA0 Q6NZA1
Symbols STBP
TH2B
H2BFU
TSH2B
TSH2B.1
bA317E16.3

Gene

PDB

3WKJ  

 GO Function (1)

Gene RIF (6)

PMID Text
26759222 Data show that histone H2B of prostate cancer cell line DU-145 have hypoacetylation, hypomethylation, and dephosphorylation, suggesting there was an excessive histone deacetylase activity in the cells.
15709765 Reconstituted TSH2B containing octamers are able to form nucleosome core particles which are structurally and dynamically indistinguishable from those reconstituted with octamers consisting of only native histones.
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTD      1 - 70
IFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                  71 - 127
//

Text Mined References (25)

PMID Year Title
26759222 2016 Hypoacetylation, hypomethylation, and dephosphorylation of H2B histones and excessive histone deacetylase activity in DU-145 prostate cancer cells.
26649967 2016 Two Histone Variants TH2A and TH2B Enhance Human Induced Pluripotent Stem Cell Generation.
24699735 2014 Structure of human nucleosome containing the testis-specific histone variant TSH2B.
24614311 2014 Every amino acid matters: essential contributions of histone variants to mammalian development and disease.
23884607 2013 Chromatin-to-nucleoprotamine transition is controlled by the histone H2B variant TH2B.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21249133 2011 Histone variants and their post-translational modifications in primary human fat cells.
19135898 2009 Purification of proteins associated with specific genomic Loci.
More...