Property Summary

NCBI Gene PubMed Count 24
PubMed Score 45.49
PubTator Score 9.50

Knowledge Summary

Patent

No data available

TINX Plot

 HCA RNA Cell Line (1)

Gene RIF (8)

AA Sequence

MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTD      1 - 70
IFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                  71 - 127
//

Text Mined References (28)

PMID Year Title