Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.48
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
tuberculosis 1,557

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.206 0.000
tuberculosis 1.300 0.000

Synonym

Accession Q96A05 V-ATPase subunit E 2
Symbols VMA4
ATP6E1
ATP6EL2
ATP6V1EL2

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
10748165 Rat vacuolar H(+)ATPase associates with NHE-RF (Na(+)/H(+) exchanger regulatory factor); the E subunit was co-immunoprecipitated from rat kidney cytosol with NHE-RF antibodies.

AA Sequence

MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKI      1 - 70
LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLVLQGLLRLLEPVMIVRCRPQD     71 - 140
LLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKVSNTLESRLDLSAKQKMPE    141 - 210
IRMALFGANTNRKFFI                                                          211 - 226
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
14580332 2003 Revised nomenclature for mammalian vacuolar-type H+ -ATPase subunit genes.
More...