Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.04
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.4e-11
ovarian cancer 8520 1.7e-08
osteosarcoma 7950 2.7e-08

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.748 2.7e-08
ovarian cancer 1.300 1.7e-08
psoriasis 1.100 1.4e-11

AA Sequence

MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLGLLECMY      1 - 70
ANLQLQTQLAQQQMAVLEHLQASVTQLAPGRGSNNSSLPALSPNPLLNHLPQFSK                    71 - 125
//

Text Mined References (8)

PMID Year Title