Property Summary

NCBI Gene PubMed Count 25
Grant Count 77
R01 Count 69
Funding $5,924,298.84
PubMed Score 314.73
PubTator Score 53.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96A00 Q7Z4X7 Q96S54
Symbols CPI17
CPI-17
PPP1INL

Gene

Gene RIF (15)

PMID Text
23800065 CPI-17 has a role in restoring skin homoeostasis in cutaneous field of cancerization lesions
23583905 analysis of the interaction between plakoglobin and CPI-17, which is affected by the phosphorylation status of CPI-17 in human lung microvascular endothelial cells
23541585 The N-terminal 21-residue tail domain of CPI-17 is necessary for nuclear localization. Phospho-mimetic Asp-substitution of CPI-17 at Ser12 attenuates the nuclear import.
23275439 The study characterized the CPI-17 promoter and identified binding sites for GATA-6 and nuclear factor kappa B (NF-kappaB).
22275376 a novel signaling cascade that links RhoA-mediated calcium sensitivity to MEF2-dependent myocardin expression in VSMCs through a mechanism involving p38 MAPK, PP1alpha, and CPI-17.
20875397 RACK1 may play a role in PKC/CPI-17 signaling pathway.
20202976 cAMP/PKA regulates the endothelial barrier via inhibition of the contractile machinery, mainly by the activation of MLCP via inhibition of CPI-17 and RhoA/Rock.
18835652 NF2 is rendered inactive by phosphorylation of Ser 518 and this can be explained at least in part by an increased expression of CPI-17.
18757304 These results are consistent with a key molecular role for CPI-17 in airway hyperresponsiveness, in the absence of bronchial wall remodeling.
17301291 Human pregnancy is characterized by increases in PKN1 expression and PPP1R14A phosphorylation in the myometrium.
More...

AA Sequence

MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGMEAD      1 - 70
MPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQD     71 - 140
RARTAHP                                                                   141 - 147
//

Text Mined References (30)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23800065 2013 Role of CPI-17 in restoring skin homoeostasis in cutaneous field of cancerization: effects of topical application of a film-forming medical device containing photolyase and UV filters.
23583905 2013 Putative protein partners for the human CPI-17 protein revealed by bacterial two-hybrid screening.
23541585 2013 Nuclear localization of CPI-17, a protein phosphatase-1 inhibitor protein, affects histone H3 phosphorylation and corresponds to proliferation of cancer and smooth muscle cells.
23275439 2013 GATA-6 and NF-?B activate CPI-17 gene transcription and regulate Ca2+ sensitization of smooth muscle contraction.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22275376 2012 A novel RhoA/ROCK-CPI-17-MEF2C signaling pathway regulates vascular smooth muscle cell gene expression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20875397 2010 A functional interaction between CPI-17 and RACK1 proteins in bronchial smooth muscle cells.
More...