Property Summary

NCBI Gene PubMed Count 25
PubMed Score 314.73
PubTator Score 53.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Colorectal Neoplasms 217
Mesothelioma 40
Disease Target Count P-value
Breast cancer 3099 8.41474253313785E-34
breast carcinoma 1614 3.65682925758023E-31
non-small cell lung cancer 2798 4.67684530516146E-29
psoriasis 6685 3.37762833126284E-26
chronic lymphosyte leukemia 232 8.08528433062503E-8
oligodendroglioma 2849 1.27628465951812E-5
cystic fibrosis 1670 1.92990408121064E-5
ductal carcinoma in situ 1745 5.47486035380765E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 9.64146036329696E-5
atypical teratoid/rhabdoid tumor 1095 1.22651115601228E-4
invasive ductal carcinoma 2950 1.36859579783687E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.68797999763452E-4
group 4 medulloblastoma 1875 2.64895126109474E-4
astrocytoma 1493 3.069545578063E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00206045765712236
subependymal giant cell astrocytoma 2287 0.00545540965968034
pediatric high grade glioma 2712 0.00696140286772905
ulcerative colitis 2087 0.00892415655689959
active Crohn's disease 918 0.0105924130583751
progressive supranuclear palsy 674 0.0222249950499152
ovarian cancer 8492 0.0288350951669701
ependymoma 2514 0.0312506595454925
osteosarcoma 7933 0.0369218714896635
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 2.0

Expression

Synonym

Accession Q96A00 Q7Z4X7 Q96S54
Symbols CPI17
CPI-17
PPP1INL

Gene

  Ortholog (9)

Gene RIF (15)

PMID Text
23800065 CPI-17 has a role in restoring skin homoeostasis in cutaneous field of cancerization lesions
23583905 analysis of the interaction between plakoglobin and CPI-17, which is affected by the phosphorylation status of CPI-17 in human lung microvascular endothelial cells
23541585 The N-terminal 21-residue tail domain of CPI-17 is necessary for nuclear localization. Phospho-mimetic Asp-substitution of CPI-17 at Ser12 attenuates the nuclear import.
23275439 The study characterized the CPI-17 promoter and identified binding sites for GATA-6 and nuclear factor kappa B (NF-kappaB).
22275376 a novel signaling cascade that links RhoA-mediated calcium sensitivity to MEF2-dependent myocardin expression in VSMCs through a mechanism involving p38 MAPK, PP1alpha, and CPI-17.
20875397 RACK1 may play a role in PKC/CPI-17 signaling pathway.
20202976 cAMP/PKA regulates the endothelial barrier via inhibition of the contractile machinery, mainly by the activation of MLCP via inhibition of CPI-17 and RhoA/Rock.
18835652 NF2 is rendered inactive by phosphorylation of Ser 518 and this can be explained at least in part by an increased expression of CPI-17.
18757304 These results are consistent with a key molecular role for CPI-17 in airway hyperresponsiveness, in the absence of bronchial wall remodeling.
17301291 Human pregnancy is characterized by increases in PKN1 expression and PPP1R14A phosphorylation in the myometrium.
More...

AA Sequence

MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGMEAD      1 - 70
MPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQD     71 - 140
RARTAHP                                                                   141 - 147
//

Text Mined References (30)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23800065 2013 Role of CPI-17 in restoring skin homoeostasis in cutaneous field of cancerization: effects of topical application of a film-forming medical device containing photolyase and UV filters.
23583905 2013 Putative protein partners for the human CPI-17 protein revealed by bacterial two-hybrid screening.
23541585 2013 Nuclear localization of CPI-17, a protein phosphatase-1 inhibitor protein, affects histone H3 phosphorylation and corresponds to proliferation of cancer and smooth muscle cells.
23275439 2013 GATA-6 and NF-?B activate CPI-17 gene transcription and regulate Ca2+ sensitization of smooth muscle contraction.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22275376 2012 A novel RhoA/ROCK-CPI-17-MEF2C signaling pathway regulates vascular smooth muscle cell gene expression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20875397 2010 A functional interaction between CPI-17 and RACK1 proteins in bronchial smooth muscle cells.
More...