Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $71,878.5
PubMed Score 59.16
PubTator Score 7.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Liver disease 219 4.106 2.1
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.000

Synonym

Accession Q969Z4 Q86V34 Q96JU1 Q9BUX7
Symbols TRLT
TNFRSF19L

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
19969290 report that overexpression of RELT or its homologues RELL1 and RELL2 in HEK 293 epithelial cells results in cell death with morphological characteristics consistent with the activation of an apoptotic pathway.
16389068 Receptor expressed in lymphoid tissue (RELT) and its novel homologues RELL1 and RELL2 co-localize with one another at the plasma membrane.

AA Sequence

MKPSLLCRPLSCFLMLLPWPLATLTSTTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHAR      1 - 70
CSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASS     71 - 140
GGETRQPGNGTRAGGPEETAAQYAVIAIVPVFCLMGLLGILVCNLLKRKGYHCTAHKEVGPGPGGGGSGI    141 - 210
NPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHICPHRHH    211 - 280
LHTVQGLASLSGPCCSRCSQKKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVGRF    281 - 350
RVARIPEQRTSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYV    351 - 420
VRLSESNLVI                                                                421 - 430
//

Text Mined References (11)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19969290 2010 RELT induces cellular death in HEK 293 epithelial cells.
16950202 2006 TRAIL-induced cleavage and inactivation of SPAK sensitizes cells to apoptosis.
16547002 2006 Interactions of tumor necrosis factor (TNF) and TNF receptor family members in the mouse and human.
16389068 2006 Identification of RELT homologues that associate with RELT and are phosphorylated by OSR1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...