Property Summary

NCBI Gene PubMed Count 11
PubMed Score 68.98
PubTator Score 7.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.8e-30
Disease Target Count Z-score Confidence
Liver disease 237 4.303 2.2
Portal vein thrombosis 12 3.351 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 3.8e-30

Gene RIF (4)

AA Sequence

MKPSLLCRPLSCFLMLLPWPLATLTSTTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHAR      1 - 70
CSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASS     71 - 140
GGETRQPGNGTRAGGPEETAAQYAVIAIVPVFCLMGLLGILVCNLLKRKGYHCTAHKEVGPGPGGGGSGI    141 - 210
NPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHICPHRHH    211 - 280
LHTVQGLASLSGPCCSRCSQKKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVGRF    281 - 350
RVARIPEQRTSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYV    351 - 420
VRLSESNLVI                                                                421 - 430
//

Text Mined References (12)

PMID Year Title