Property Summary

NCBI Gene PubMed Count 21
PubMed Score 21.22
PubTator Score 18.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 2.1e-18
lung adenocarcinoma 2716 3.7e-10
malignant mesothelioma 3232 3.1e-06
Disease Target Count Z-score Confidence
Cardiac arrest 36 3.751 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.200 3.7e-10
malignant mesothelioma 1.100 3.1e-06
non-small cell lung cancer 1.088 2.1e-18

Gene RIF (7)

AA Sequence

MAAHLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEK      1 - 70
QVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKPEDKGLLIQDAHFHQLLCLLNSQIAS     71 - 140
VWHGTLSKLLGSLYALGIPKASKELQSVEQEVRWRMRKLKYKHLAFLAESCATLSQEQHSQELLAELLTH    141 - 210
LERRWTEIEDSHTLVTVMMKVGHLSEPLMNRLEDKCLELVEHFGPNELRKVLVMLAAQSRRSVPLLRAIS    211 - 280
YHLVQKPFSLTKDVLLDVAYAYGKLSFHQTQVSQRLATDLLSLMPSLTSGEVAHCAKSFALLKWLSLPLF    281 - 350
EAFAQHVLNRAQDITLPHLCSVLLAFARLNFHPDQEDQFFSLVHEKLGSELPGLEPALQVDLVWALCVLQ    351 - 420
QAREAELQAVLHPEFHIQFLGGKSQKDQNTFQKLLHINATALLEYPEYSGPLLPASAVAPGPSALDRKVT    421 - 490
PLQKELQETLKGLLGSADKGSLEVATQYGWVLDAEVLLDSDGEFLPVRDFVAPHLAQPTGSQSPPPGSKR    491 - 560
LAFLRWEFPNFNSRSKDLLGRFVLARRHIVAAGFLIVDVPFYEWLELKSEWQKGAYLKDKMRKAVAEELA    561 - 630
K//

Text Mined References (28)

PMID Year Title