Property Summary

NCBI Gene PubMed Count 18
PubMed Score 17.32
PubTator Score 18.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.1083259306814E-18
lung adenocarcinoma 2714 3.7200349821991E-10
malignant mesothelioma 3163 3.07621118587866E-6
Disease Target Count Z-score Confidence
Cardiac arrest 26 3.505 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
non-small cell lung cancer 1.088 0.000
lung adenocarcinoma 1.200 0.000

Synonym

Accession Q969Z0 A4D2L2 A4D2L3 D3DVL5 D3DVL6 O14710 Q53GI8 Q8NDM4 Q9BUC6 Q9Y2F6
Symbols CPR2
FASTKD4

Gene

  Ortholog (11)

Gene RIF (4)

PMID Text
22190034 HIV-1 Vpu is identified to have a physical interaction with transforming growth factor beta regulator 4 (TBRG4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
9383053 13 human CPR (cell cycle progression restoration) genes and 11 yeast OPY (overproduction-induced pheromone-resistant yeast) genes that specifically block the G1 arrest by mating pheromone.

AA Sequence

MAAHLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEK      1 - 70
QVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKPEDKGLLIQDAHFHQLLCLLNSQIAS     71 - 140
VWHGTLSKLLGSLYALGIPKASKELQSVEQEVRWRMRKLKYKHLAFLAESCATLSQEQHSQELLAELLTH    141 - 210
LERRWTEIEDSHTLVTVMMKVGHLSEPLMNRLEDKCLELVEHFGPNELRKVLVMLAAQSRRSVPLLRAIS    211 - 280
YHLVQKPFSLTKDVLLDVAYAYGKLSFHQTQVSQRLATDLLSLMPSLTSGEVAHCAKSFALLKWLSLPLF    281 - 350
EAFAQHVLNRAQDITLPHLCSVLLAFARLNFHPDQEDQFFSLVHEKLGSELPGLEPALQVDLVWALCVLQ    351 - 420
QAREAELQAVLHPEFHIQFLGGKSQKDQNTFQKLLHINATALLEYPEYSGPLLPASAVAPGPSALDRKVT    421 - 490
PLQKELQETLKGLLGSADKGSLEVATQYGWVLDAEVLLDSDGEFLPVRDFVAPHLAQPTGSQSPPPGSKR    491 - 560
LAFLRWEFPNFNSRSKDLLGRFVLARRHIVAAGFLIVDVPFYEWLELKSEWQKGAYLKDKMRKAVAEELA    561 - 630
K//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20869947 2010 Fast kinase domain-containing protein 3 is a mitochondrial protein essential for cellular respiration.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...